CASP1 (Mus musculus)
Description [+]
- Synonyms: CASP1, CASPASE 1, CASPASE-1, ICE, IL1BC, INTERLEUKIN 1 BETA-CONVERTING ENZYME
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: caspase 1 Gene [Source:MGI Symbol;Acc:MGI:96544]
- Family: CASPASE
- Process: immunity,
- Pathways: inflammasome,
- Criteria: manually curated
- Curator comment:
- Human ortholog(s): CASP1
- WIKI: CASP1-M_musculus
References [+]
- Characterization of mice deficient in interleukin-1 beta converting enzyme.
- Li P, Allen H, Banerjee S, Seshadri T
- Interleukin-1 beta converting enzyme (ICE) processes the inactive prolL-1 beta to the proinflammatory mature IL-1 beta. ICE belongs to a family of cysteine proteases that have been implicated in apoptosis. To address the biological functions of ICE, we generated ICE-deficient mice through gene targeting technology. ICE-deficient mice developed normally, appeared healthy, and were fertile. Peritoneal macrophages from ICE-deficient mice underwent apoptosis normally upon ATP treatment. Thymocytes from young ICE-deficient mice also underwent apoptosis when triggered by dexamethasone, gamma irradiation, or aging. ICE-deficient mice had a major defect in the production of mature IL-1 beta and had impaired IL-1 alpha production on LPS stimulation in vitro and in vivo. ICE-deficient mice were resistant to LPS-induced endotoxic shock. J Cell Biochem. 1997 Jan;64(1):27-32.
- References from Human ortholog(s):
- Molecular cloning of the interleukin-1 beta converting enzyme.
- Cerretti DP, Kozlosky CJ, Mosley B, Nelson N, Van Ness K, Greenstreet TA, March CJ, Kronheim SR, Druck T, Cannizzaro LA, et al.
- Interleukin-1 beta (IL-1 beta) mediates a wide range of immune and inflammatory responses. The active cytokine is generated by proteolytic cleavage of an inactive precursor. A complementary DNA encoding a protease that carries out this cleavage has been cloned. Recombinant expression in COS-7 cells enabled the cells to process precursor IL-1 beta to the mature form. Sequence analysis indicated that the enzyme itself may undergo proteolytic processing. The gene encoding the protease was mapped to chromosomal band 11q23, a site frequently involved in rearrangement in human cancers. Science. 1992 Apr 3;256(5053):97-100.
- The PYRIN-CARD protein ASC is an activating adaptor for caspase-1.
- Srinivasula SM, Poyet JL, Razmara M, Datta P, Zhang Z, Alnemri ES
- The PYRIN and CARD domains are members of the six-helix bundle death domain-fold superfamily that mediates assembly of large signaling complexes in the apoptotic and inflammatory signaling pathways. Here we show that the PYRIN-CARD protein ASC functions as a caspase-1-activating adaptor. ASC interacted specifically with procaspase-1 via CARD-CARD interactions and induced its oligomerization. Consistent with these results ectopic expression of full-length ASC, but not its isolated CARD or PYRIN domain, with procaspase-1 induced activation of procaspase-1 and processing of pro-interleukin-1beta in transfected cells. Substitution of the PYRIN domain of ASC with an inducible FKBP12 oligomerization domain produced a molecule that can induce caspase-1 activation in response to stimulation with the oligomerization drug AP20187, suggesting that the PYRIN domain functions as an oligomerization domain, whereas the CARD domain functions as the effector domain in the caspase-1 activation pathway. Furthermore stable expression of an isolated CARD of ASC in THP-1 cells diminished interleukin-1beta generation in response to pro-inflammatory cytokines. These results indicate that ASC is involved in the caspase-1 signaling pathway by mediating the assembly of a caspase-1-inflammasome signaling complex in response to pro-inflammatory cytokine stimulation. J Biol Chem. 2002 Jun 14;277(24):21119-22. Epub 2002 Apr 19.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | CARD | 3 | 90 |
PFAM A | Peptidase_C14 | 162 | 398 |
Protein sequence [+]
Casp1 | Mus musculus | 10090 | length:402
MADKILRAKRKQFINSVSIGTINGLLDELLEKRVLNQEEMDKIKLANITAMDKARDLCDH
VSKKGPQASQIFITYICNEDCYLAGILELQSAPSAETFVATEDSKGGHPSSSETKEEQNK
EDGTFPGLTGTLKFCPLEKAQKLWKENPSEIYPIMNTTTRTRLALIICNTEFQHLSPRVG
AQVDLREMKLLLEDLGYTVKVKENLTALEMVKEVKEFAACPEHKTSDSTFLVFMSHGIQE
GICGTTYSNEVSDILKVDTIFQMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVRD
SEEDFLTDAIFEDDGIKKAHIEKDFIAFCSSTPDNVSWRHPVRGSLFIESLIKHMKEYAW
SCDLEDIFRKVRFSFEQPEFRLQMPTADRVTLTKRFYLFPGH
VSKKGPQASQIFITYICNEDCYLAGILELQSAPSAETFVATEDSKGGHPSSSETKEEQNK
EDGTFPGLTGTLKFCPLEKAQKLWKENPSEIYPIMNTTTRTRLALIICNTEFQHLSPRVG
AQVDLREMKLLLEDLGYTVKVKENLTALEMVKEVKEFAACPEHKTSDSTFLVFMSHGIQE
GICGTTYSNEVSDILKVDTIFQMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVRD
SEEDFLTDAIFEDDGIKKAHIEKDFIAFCSSTPDNVSWRHPVRGSLFIESLIKHMKEYAW
SCDLEDIFRKVRFSFEQPEFRLQMPTADRVTLTKRFYLFPGH
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|---|---|
NP_990255.1 | orthology | Chicken |
CASP1 | orthology | Chimpanzee |
A0PCH9_BOVIN | orthology | Cow |
T_rubripes_ENSTRUP00000013027 | orthology | Fugu |
T_rubripes_ENSTRUP00000035020 | orthology | Fugu |
T_rubripes_ENSTRUP00000019853 | orthology | Fugu |
CASP12 | orthology | Gasterosteus |
CASP1_HORSE | orthology | Horse |
CASP1 | orthology | Human |
A_carolinensis_ENSACAP00000013361 | orthology | Lyzard |
CASP1 | orthology | Macaca |
CASP12 | orthology | Medaka |
M_domestica_ENSMODP00000034033 | orthology | Monodelphis |
M_domestica_ENSMODP00000034022 | orthology | Monodelphis |
M_domestica_ENSMODP00000034020 | orthology | Monodelphis |
CASP1 | orthology | Orangutan |
O_anatinus_ENSOANP00000016591 | orthology | Ornithorhynchus |
CASP1 | orthology | Rabbit |
Casp1 | orthology | Rat |
X_tropicalis_ENSXETP00000017024 | orthology | Xenopus |
LOC566185 | orthology | Zebrafish |
caspb | orthology | Zebrafish |
caspa | orthology | Zebrafish |
A_aegypti_AAEL003444-PA | paralogy | Aedes |
CASPS8 | paralogy | Anopheles |
CASPS4 | paralogy | Anopheles |
CASPS6 | paralogy | Anopheles |
CASPS7 | paralogy | Anopheles |
CASP2_CHICK | paralogy | Chicken |
NP_990057.1 | paralogy | Chicken |
Q90WU0_CHICK | paralogy | Chicken |
NP_989923.1 | paralogy | Chicken |
NP_990056.1 | paralogy | Chicken |
CASP2 | paralogy | Chimpanzee |
CARD16 | paralogy | Chimpanzee |
CASP12 | paralogy | Chimpanzee |
XR_019722.1 | paralogy | Chimpanzee |
CASP4 | paralogy | Chimpanzee |
CASP3_PANTR | paralogy | Chimpanzee |
CASP6 | paralogy | Chimpanzee |
CASP9 | paralogy | Chimpanzee |
XR_025516.1 | paralogy | Chimpanzee |
C_intestinalis_ENSCINP00000003204 | paralogy | Ciona |
C_intestinalis_ENSCINP00000002956 | paralogy | Ciona |
C_intestinalis_ENSCINP00000007986 | paralogy | Ciona |
IPI00704513.4 | paralogy | Cow |
IPI00707783.1 | paralogy | Cow |
CASPD_BOVIN | paralogy | Cow |
CASP1_CANFA | paralogy | Dog |
CASP14 | paralogy | Dog |
CASP3_CANFA | paralogy | Dog |
Q45T68_CANFA | paralogy | Dog |
CASP6 | paralogy | Dog |
CASP2 | paralogy | Dog |
CASP12 | paralogy | Dog |
C_familiaris_ENSCAFP00000007585 | paralogy | Dog |
Dcp-1 | paralogy | Fly |
Ice | paralogy | Fly |
T_rubripes_ENSTRUP00000024164 | paralogy | Fugu |
NP_001027871.1 | paralogy | Fugu |
T_rubripes_ENSTRUP00000044662 | paralogy | Fugu |
CASP2 | paralogy | Fugu |
CASP9 | paralogy | Fugu |
CASP6 | paralogy | Gasterosteus |
CASP9 | paralogy | Gasterosteus |
CASP3 (2 of 4) | paralogy | Gasterosteus |
CASP2 | paralogy | Gasterosteus |
G_aculeatus_ENSGACP00000005791 | paralogy | Gasterosteus |
CASP3 (4 of 4) | paralogy | Gasterosteus |
CASP3 (1 of 4) | paralogy | Gasterosteus |
CASP5 | paralogy | Gorilla |
CASP14 | paralogy | Horse |
CASP2 | paralogy | Horse |
CASP10 | paralogy | Horse |
CASP12 | paralogy | Horse |
Q3S2Z5_HORSE | paralogy | Horse |
CASP4 | paralogy | Horse |
CASP9 | paralogy | Horse |
CARD16 | paralogy | Human |
CASP6 | paralogy | Human |
CASP3 | paralogy | Human |
CASP5 | paralogy | Human |
CASP2 | paralogy | Human |
CASP9 | paralogy | Human |
CASP4 | paralogy | Human |
CASP12 | paralogy | Human |
CASP10 | paralogy | Human |
CASP3 | paralogy | Lyzard |
CASP6 | paralogy | Lyzard |
CASP2 | paralogy | Lyzard |
CASP5 | paralogy | Macaca |
CASP9 | paralogy | Macaca |
CASP10 | paralogy | Macaca |
Q8SPP8_MACMU | paralogy | Macaca |
Q8SPU2_MACMU | paralogy | Macaca |
CASP12 | paralogy | Macaca |
CASP4 | paralogy | Macaca |
Q8JIS9_ORYLA | paralogy | Medaka |
CASP9 | paralogy | Medaka |
CASP2 | paralogy | Medaka |
CASP10 | paralogy | Monodelphis |
NP_001033061.1 | paralogy | Monodelphis |
CASP2 | paralogy | Monodelphis |
CASP9 | paralogy | Monodelphis |
NP_001033059.1 | paralogy | Monodelphis |
Casp9 | paralogy | Mouse |
Casp2 | paralogy | Mouse |
Casp3 | paralogy | Mouse |
Casp4 | paralogy | Mouse |
Casp12 | paralogy | Mouse |
CASP4 | paralogy | Orangutan |
CASP12 | paralogy | Orangutan |
CASP5 | paralogy | Orangutan |
CASP6 | paralogy | Orangutan |
CASP2 | paralogy | Orangutan |
CASP9 | paralogy | Orangutan |
Q5RB11_PONPY | paralogy | Orangutan |
CASP3 | paralogy | Orangutan |
CASP2 | paralogy | Ornithorhynchus |
CASP3 | paralogy | Ornithorhynchus |
CASP9 | paralogy | Ornithorhynchus |
CASP2 | paralogy | Rabbit |
Casp12 | paralogy | Rat |
Casp2 | paralogy | Rat |
Casp14_predicted | paralogy | Rat |
Casp9 | paralogy | Rat |
Casp4 | paralogy | Rat |
Casp3 | paralogy | Rat |
CASP7 | paralogy | Tetraodon |
CASP9 | paralogy | Tetraodon |
CASP3 | paralogy | Tetraodon |
T_nigroviridis_ENSTNIP00000001216 | paralogy | Tetraodon |
ced-3 | paralogy | Worm |
CASP2 | paralogy | Xenopus |
casp6 | paralogy | Xenopus |
CASP3 | paralogy | Xenopus |
casp7 | paralogy | Xenopus |
CASP3 | paralogy | Zebra finch |
CASP9 | paralogy | Zebra finch |
T_guttata_ENSTGUP00000013612 | paralogy | Zebra finch |
T_guttata_ENSTGUP00000004278 | paralogy | Zebra finch |
CASP8 | paralogy | Zebra finch |
LOC563034 | paralogy | Zebrafish |
NP_001077331.1 | paralogy | Zebrafish |
LOC100000522 | paralogy | Zebrafish |
LOC795066 | paralogy | Zebrafish |
casp2 | paralogy | Zebrafish |
A2BGE2_DANRE | paralogy | Zebrafish |
casp3a | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0001666 | response to hypoxia | biological_proccess | IMP |
GO:0006508 | proteolysis | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IMP |
GO:0008219 | cell death | biological_proccess | IDA |
GO:0016485 | protein processing | biological_proccess | IMP |
GO:0033198 | response to ATP | biological_proccess | IMP |
GO:0042221 | response to chemical stimulus | biological_proccess | IDA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0050715 | positive regulation of cytokine secretion | biological_proccess | IMP |
GO:0050717 | positive regulation of interleukin-1 alpha secretion | biological_proccess | IMP |
GO:0050718 | positive regulation of interleukin-1 beta secretion | biological_proccess | IMP |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0004197 | cysteine-type endopeptidase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0008233 | peptidase activity | mollecular_function | IDA |
GO:0016787 | hydrolase activity | mollecular_function | IEA |
GO:0008234 | cysteine-type peptidase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005576 | extracellular region | cell_component | IDA |
GO:0005622 | intracellular | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | TAS |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from MGI [?] MGI:96544
- Ensembl genome browser [?] : ENSMUSG00000025888
- Expression info from Arrayexpress [?] : ENSMUSG00000025888
- Protein expression from Protein Atlas: [?] ENSMUSG00000025888
- Community gene edition from Wikigenes: [?] 100044207
Click on [?] for more information.