CARD16 (Homo sapiens)
Description [+]
- Synonyms: CARD16
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Caspase-1 inhibitor COP (CARD only domain-containing protein 1)(Pseudo interleukin-1 beta converting enzyme)(Pseudo-ICE) [Source:UniProtKB/Swiss-Prot;Acc:Q5EG05]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CARD16-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | CARD | 3 | 90 |
Protein sequence [+]
CARD16 | Homo sapiens | 9606 | length:197
MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDS
VIPKGAQACQICITYICEEDSYLAETLGLSAALQAVQDNPAMPTCSSPEGRIKLCFLEDA
QRIWKQKLQRCHVQNTIIKWSERYTSGSFEMQWLFLRTNFIERFWRNILLLPLHKGSLYP
RIPGLGKELQTGTHKLS
VIPKGAQACQICITYICEEDSYLAETLGLSAALQAVQDNPAMPTCSSPEGRIKLCFLEDA
QRIWKQKLQRCHVQNTIIKWSERYTSGSFEMQWLFLRTNFIERFWRNILLLPLHKGSLYP
RIPGLGKELQTGTHKLS
Structure links:
Evolution [+]
Explore tree at phylomeDB: Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0006508 | proteolysis | biological_proccess | IEA |
| GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
| GO:0004197 | cysteine-type endopeptidase activity | mollecular_function | IEA |
| GO:0005515 | protein binding | mollecular_function | IEA |
| GO:0004869 | cysteine-type endopeptidase inhibitor activity | mollecular_function | IEA |
| GO:0030414 | peptidase inhibitor activity | mollecular_function | IEA |
| GO:0005622 | intracellular | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from HGNC [?] :33701
- Gene related info from GeneCards [?] : CARD16
- Ensembl genome browser [?] : ENSG00000204397
- Expression info from Arrayexpress [?] : ENSG00000204397
- Protein expression from Protein Atlas: [?] ENSG00000204397
- Community gene edition from Wikigenes: [?] 114769
- entrezgene: 114769
- refseq_dna: NM_001017534
- refseq_dna: NM_052889
- refseq_peptide: NP_001017534
- refseq_peptide: NP_443121
Click on [?] for more information.
