CASP12 (Macaca mulatta)
Description [+]
- Synonyms: CASP12
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Cercopithecidae; Macaca mulatta
- Short gene description: Inactive caspase-12 (CASP-12) [Source:UniProtKB/Swiss-Prot;Acc:Q6UXS9]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CASP12-M_mulatta
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Peptidase_C14 | 46 | 284 |
Protein sequence [+]
CASP12 | Macaca mulatta | 9544 | length:286
LSAPLEIQGAQPSGRLKLCPHAHFRELKTKRADEIYPVMEKEGRTRLALIICNKEFHYLL
NRNGSELDLLGMQDLLENLGYSVVIEENLTAQEMETALRQFAARPEHQSSDSTFLVFMSH
GILNGICGTEHWDQEPDVLHDDTIFEIFNNRNCRSLRDKPKVIIMQACRGSGAGIVWFTT
DSGKASAETHGQLLQSSICNDAVTKAHVEKDFIAFKSSTPHNVSWRHEISGSVFISQIIY
YFKEYSWSHHLEEIFRKFERSFETPNVVTQLPTIMLISIFIYFILF
NRNGSELDLLGMQDLLENLGYSVVIEENLTAQEMETALRQFAARPEHQSSDSTFLVFMSH
GILNGICGTEHWDQEPDVLHDDTIFEIFNNRNCRSLRDKPKVIIMQACRGSGAGIVWFTT
DSGKASAETHGQLLQSSICNDAVTKAHVEKDFIAFKSSTPHNVSWRHEISGSVFISQIIY
YFKEYSWSHHLEEIFRKFERSFETPNVVTQLPTIMLISIFIYFILF
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006508 | proteolysis | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0030968 | endoplasmic reticulum unfolded protein response | biological_proccess | IEA |
GO:0006926 | virus-infected cell apoptosis | biological_proccess | IEA |
GO:0070059 | apoptosis in response to endoplasmic reticulum stress | biological_proccess | IEA |
GO:0004197 | cysteine-type endopeptidase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0008233 | peptidase activity | mollecular_function | IEA |
GO:0008234 | cysteine-type peptidase activity | mollecular_function | IEA |
GO:0016787 | hydrolase activity | mollecular_function | IEA |
GO:0005622 | intracellular | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSMMUG00000016548
- Expression info from Arrayexpress [?] : ENSMMUG00000016548
- Protein expression from Protein Atlas: [?] ENSMMUG00000016548
Click on [?] for more information.