CASP3 (Ornithorhynchus anatinus)
Description [+]
- Synonyms: CASP3
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Prototheria; Ornithorhynchus anatinus
- Short gene description: Caspase-3 Precursor (CASP-3)(EC 3.4.22.56)(Apopain)(Cysteine protease CPP32)(CPP-32)(Yama protein)(SREBP cleavage activity 1)(SCA-1) [Contains Caspase-3 subunit p17;Caspase-3 subunit p12] [Source:UniProtKB/Swiss-Prot;Acc:P42574]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CASP3-O_anatinus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Peptidase_C14 | 48 | 278 |
Protein sequence [+]
CASP3 | Ornithorhynchus anatinus | 9258 | length:280
AASGEVMVDSKSFHSSQGYSSRKVPGKQFLGSSASLDDRYRMDYPNMGICLIINNKNFHP
DTRMGCRSGTDVDAASLRDTFKKLKYEVRCKNDLKRREILELLTSVAHEDHSKRSSFVCV
LLSHGEEGVIFGTDGSLELKSLASLFRGDNCRSLVGKPKLFIVQACRGTELDSGVEADSS
SADDGSEQKIPVEADFLYAYSTAPGYYSWRNSMNGSWFIQALCAMLKQHAHTLELLHILT
RVNRKVATEFESYSLDATFNAKKQIPCIVSMLTKELYFPY
DTRMGCRSGTDVDAASLRDTFKKLKYEVRCKNDLKRREILELLTSVAHEDHSKRSSFVCV
LLSHGEEGVIFGTDGSLELKSLASLFRGDNCRSLVGKPKLFIVQACRGTELDSGVEADSS
SADDGSEQKIPVEADFLYAYSTAPGYYSWRNSMNGSWFIQALCAMLKQHAHTLELLHILT
RVNRKVATEFESYSLDATFNAKKQIPCIVSMLTKELYFPY
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006508 | proteolysis | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0001782 | B cell homeostasis | biological_proccess | IEA |
GO:0007507 | heart development | biological_proccess | IEA |
GO:0006974 | response to DNA damage stimulus | biological_proccess | IEA |
GO:0006309 | DNA fragmentation during apoptosis | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0007605 | sensory perception of sound | biological_proccess | IEA |
GO:0045786 | negative regulation of cell cycle | biological_proccess | IEA |
GO:0045736 | negative regulation of cyclin-dependent protein kinase activity | biological_proccess | IEA |
GO:0051402 | neuron apoptosis | biological_proccess | IEA |
GO:0043029 | T cell homeostasis | biological_proccess | IEA |
GO:0030889 | negative regulation of B cell proliferation | biological_proccess | IEA |
GO:0045165 | cell fate commitment | biological_proccess | IEA |
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IEA |
GO:0030216 | keratinocyte differentiation | biological_proccess | IEA |
GO:0009411 | response to UV | biological_proccess | IEA |
GO:0008631 | induction of apoptosis by oxidative stress | biological_proccess | IEA |
GO:0009611 | response to wounding | biological_proccess | IEA |
GO:0008625 | induction of apoptosis via death domain receptors | biological_proccess | IEA |
GO:0046007 | negative regulation of activated T cell proliferation | biological_proccess | IEA |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IEA |
GO:0030264 | nuclear fragmentation during apoptosis | biological_proccess | IEA |
GO:0008234 | cysteine-type peptidase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0004861 | cyclin-dependent protein kinase inhibitor activity | mollecular_function | IEA |
GO:0008233 | peptidase activity | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSOANG00000000305
- Expression info from Arrayexpress [?] : ENSOANG00000000305
- Protein expression from Protein Atlas: [?] ENSOANG00000000305
- entrezgene: 100087105
Click on [?] for more information.