CASP14_PREDICTED (Rattus norvegicus)
Description [+]
- Synonyms: CASP14_PREDICTED
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description:
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CASP14_PREDICTED-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Peptidase_C14 | 22 | 245 |
Protein sequence [+]
Casp14_predicted | Rattus norvegicus | 10116 | length:246
MDSETINPQPLQEERYDMSGARLALTLCVTKAREGSEVDMDALERMFQYLKFESTMKRDP
TAQQFLDDMDEFQQTIENWKEPVSCAFVVLMAHGEEGFLKGEDGNMVRLEDLFEVLNNKN
CKALRGKPKVYIIQACRGEHRDPGEELPGDELAVIKKKNPPTIPTYTDMIHIYSTVEGFL
SYRHDQKGSGFIQTLTDVFIHKKGSITELLEEITRLMANTEVMQEGKPRKVNPEIQSTLR
KKLYLQ
TAQQFLDDMDEFQQTIENWKEPVSCAFVVLMAHGEEGFLKGEDGNMVRLEDLFEVLNNKN
CKALRGKPKVYIIQACRGEHRDPGEELPGDELAVIKKKNPPTIPTYTDMIHIYSTVEGFL
SYRHDQKGSGFIQTLTDVFIHKKGSITELLEEITRLMANTEVMQEGKPRKVNPEIQSTLR
KKLYLQ
Structure links:
- Smartdomain prediction information: SM00115
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006508 | proteolysis | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0004197 | cysteine-type endopeptidase activity | mollecular_function | IEA |
GO:0008234 | cysteine-type peptidase activity | mollecular_function | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000007352
- Expression info from Arrayexpress [?] : ENSRNOG00000007352
- Protein expression from Protein Atlas: [?] ENSRNOG00000007352
- entrezgene: 299587
Click on [?] for more information.