CASP5 (Homo sapiens)
Description [+]
- Synonyms: CASP5, ICE(REL)III
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Caspase-5 Precursor (CASP-5)(EC 3.4.22.58)(ICH-3 protease)(TY protease)(ICE(rel)-III) [Contains Caspase-5 subunit p20;Caspase-5 subunit p10] [Source:UniProtKB/Swiss-Prot;Acc:P51878]
- Family: CASPASE
- Process: immunity,
- Pathways: inflammasome,
- Criteria: manually curated
- Curator comment:
- Mouse ortholog(s): Casp4
- WIKI: CASP5-H_sapiens
References [+]
- Inflammatory caspases: linking an intracellular innate immune system to autoinflammatory diseases.
- Martinon F, Tschopp J
- Caspases not only play an essential role during apoptotic cell death, but a subfamily of them-the inflammatory caspases-are associated with immune responses to microbial pathogens. Activation of inflammatory caspases, such as caspase-1 and caspase-5, occurs upon assembly of an intracellular complex, designated the inflammasome. This results in the cleavage and activation of the proinflammatory cytokines IL-1beta and IL-18. Mutations in one of the scaffold proteins of the inflammasome, NALP3/Cryopyrin, are associated with autoinflammatory disorders underscoring the importance of regulating inflammatory caspase activation. Cell. 2004 May 28;117(5):561-74.
- Identification of a cysteine protease closely related to interleukin-1 beta-converting enzyme.
- Faucheu C, Blanchet AM, Collard-Dutilleul V, Lalanne JL, Diu-Hercend A
- The present study describes the identification and molecular cloning of a new member of the interleukin-1 beta-converting enzyme (ICE) family denoted transcript Y (TY). TY is very closely related to both ICE (51% amino acid identity) and a protein named transcript X (TX) (75% amino acid identity) that we recently identified [Faucheu, C., Diu, A., Chan, A.W.E., Blanchet, A.-M., Miossec, C., Herve, F.,Collard-Dutilleul, V., Gu, Y., Aldape, R., Lippke, J., Rocher, C., Su, M.S.-S., Livingston, D.J., Hercend, T. & Lalanne, J.-L. (1995) EMBO J. 14, 1914-1922]. The amino acids that are implicated in both the ICE catalytic site and in the PI aspartate-binding pocket are conserved in TY. Within the ICE gene family, TY belongs to a subfamily of proteins closely related to the prototype ICE protein. Using transfection experiments into mammalian cells, we demonstrate that TY has protease activity on its own precursor and that this activity is dependent on the presence of a cysteine residue at position 245. However, despite the close similarity between TY and ICE active sites, TY fails to process the interleukin-1 beta precursor. In addition, as already observed for ICE and TX, TY is able to induce apoptosis when overexpressed in COS cells. TY therefore represents a new member of the growing family of apoptosis-inducing ICE-related cysteine proteases. Eur J Biochem. 1996 Feb 15;236(1):207-13.
- References from Mouse ortholog(s):
- Murine caspase-11, an ICE-interacting protease, is essential for the activation of ICE.
- Wang S, Miura M, Jung YK, Zhu H, Li E, Yuan J
- We report here the inactivation of a member of the Ice/Ced-3 (caspase) family of cell death genes, casp-11, by gene targeting. Like Ice-deficient mice, casp-11 mutant mice are resistant to endotoxic shock induced by lipopolysaccharide. Production of both IL-1alpha and IL-1beta after lipopolysaccharide stimulation, a crucial event during septic shock and an indication of ICE activation, is blocked in casp-11 mutant mice. casp-11 mutant embryonic fibroblast cells are resistant to apoptosis induced by overexpression of ICE. Furthermore, we found that pro-caspase-11 physically interacts with pro-ICE in cells, and the expression of casp-11 is essential for activation of ICE. Our data suggest that caspase-11 is a component of ICE complex and is required for the activation of ICE. Cell. 1998 Feb 20;92(4):501-9.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | CARD | 72 | 158 |
| PFAM A | Peptidase_C14 | 204 | 441 |
Protein sequence [+]
CASP5 | Homo sapiens | 9606 | length:445
AVPRVEGVFIFLIEDSGKKKRRKNFEAMFKGILQSGLDNFVINHMLKNNVAGQTSIQTLV
PNTDQKSTSVKKDNHKKKTVKMLEYLGKDVLHGVFNYLAKHDVLTLKEEEKKKYYDTKIE
DKALILVDSLRKNRVAHQMFTQTLLNMDQKITSVKPLLQIEAGPPESAESTNILKLCPRE
EFLRLCKKNHDEIYPIKKREDRRRLALIICNTKFDHLPARNGAHYDIVGMKRLLQGLGYT
VVDEKNLTARDMESVLRAFAARPEHKSSDSTFLVLMSHGILEGICGTAHKKKKPDVLLYD
TIFQIFNNRNCLSLKDKPKVIIVQACRGEKHGELWVRDSPASLALISSQSSENLEADSVC
KIHEEKDFIAFCSSTPHNVSWRDRTRGSIFITELITCFQKYSCCCHLMEIFRKVQKSFEV
PQAKAQMPTIERATLTRDFYLFPGN
PNTDQKSTSVKKDNHKKKTVKMLEYLGKDVLHGVFNYLAKHDVLTLKEEEKKKYYDTKIE
DKALILVDSLRKNRVAHQMFTQTLLNMDQKITSVKPLLQIEAGPPESAESTNILKLCPRE
EFLRLCKKNHDEIYPIKKREDRRRLALIICNTKFDHLPARNGAHYDIVGMKRLLQGLGYT
VVDEKNLTARDMESVLRAFAARPEHKSSDSTFLVLMSHGILEGICGTAHKKKKPDVLLYD
TIFQIFNNRNCLSLKDKPKVIIVQACRGEKHGELWVRDSPASLALISSQSSENLEADSVC
KIHEEKDFIAFCSSTPHNVSWRDRTRGSIFITELITCFQKYSCCCHLMEIFRKVQKSFEV
PQAKAQMPTIERATLTRDFYLFPGN
Structure links:
- Smartdomain prediction information: SM00114
- Smartdomain prediction information: SM00115
- Prosite motif and domain information: PS01121
- Prosite motif and domain information: PS01122
- Profile motif and domain profile information: PS50209
- Profile motif and domain profile information: PS50207
- Profile motif and domain profile information: PS50208
- Interpro domain information: P51878
- PFAM domain and domain family information: P51878
Evolution [+]
View protein alignment and tree with Jalview:
Explore tree at phylomeDB: Click here.
Homologs list [+]
| Name | Relationship | Species |
|---|---|---|
| NP_990255.1 | orthology | Chicken |
| XR_019722.1 | orthology | Chimpanzee |
| T_rubripes_ENSTRUP00000013027 | orthology | Fugu |
| T_rubripes_ENSTRUP00000019853 | orthology | Fugu |
| T_rubripes_ENSTRUP00000035020 | orthology | Fugu |
| CASP12 | orthology | Gasterosteus |
| CASP5 | orthology | Gorilla |
| A_carolinensis_ENSACAP00000013361 | orthology | Lyzard |
| CASP5 | orthology | Macaca |
| CASP12 | orthology | Medaka |
| Casp4 | orthology | Mouse |
| CASP5 | orthology | Orangutan |
| CASP4 | orthology | Rabbit |
| Casp4 | orthology | Rat |
| X_tropicalis_ENSXETP00000017024 | orthology | Xenopus |
| caspa | orthology | Zebrafish |
| LOC566185 | orthology | Zebrafish |
| caspb | orthology | Zebrafish |
| A_aegypti_AAEL003444-PA | paralogy | Aedes |
| CASPS7 | paralogy | Anopheles |
| CASPS4 | paralogy | Anopheles |
| NP_990056.1 | paralogy | Chicken |
| NP_990057.1 | paralogy | Chicken |
| CASP2_CHICK | paralogy | Chicken |
| Q90WU0_CHICK | paralogy | Chicken |
| CASP10 | paralogy | Chicken |
| CASP7 | paralogy | Chicken |
| CASP1 | paralogy | Chimpanzee |
| CASP7 | paralogy | Chimpanzee |
| CASP2 | paralogy | Chimpanzee |
| CASP4 | paralogy | Chimpanzee |
| CASP12 | paralogy | Chimpanzee |
| XR_025516.1 | paralogy | Chimpanzee |
| CASP3_PANTR | paralogy | Chimpanzee |
| CASP9 | paralogy | Chimpanzee |
| C_intestinalis_ENSCINP00000011493 | paralogy | Ciona |
| C_intestinalis_ENSCINP00000024485 | paralogy | Ciona |
| C_intestinalis_ENSCINP00000002956 | paralogy | Ciona |
| C_intestinalis_ENSCINP00000007986 | paralogy | Ciona |
| IPI00704513.4 | paralogy | Cow |
| IPI00689801.3 | paralogy | Cow |
| NP_001029681.1 | paralogy | Cow |
| IPI00707783.1 | paralogy | Cow |
| CASPD_BOVIN | paralogy | Cow |
| A0PCH9_BOVIN | paralogy | Cow |
| IPI00688117.2 | paralogy | Cow |
| CASP2 | paralogy | Dog |
| CASP12 | paralogy | Dog |
| CASP14 | paralogy | Dog |
| Q45T68_CANFA | paralogy | Dog |
| CASP1_CANFA | paralogy | Dog |
| CASP3_CANFA | paralogy | Dog |
| Ice | paralogy | Fly |
| CASP6 | paralogy | Fugu |
| CASP7 | paralogy | Fugu |
| CASP2 | paralogy | Fugu |
| NP_001027871.1 | paralogy | Fugu |
| T_rubripes_ENSTRUP00000044662 | paralogy | Fugu |
| CASP7 | paralogy | Gasterosteus |
| CASP2 | paralogy | Gasterosteus |
| CASP3 (4 of 4) | paralogy | Gasterosteus |
| CASP3 (3 of 4) | paralogy | Gasterosteus |
| CASP3 (2 of 4) | paralogy | Gasterosteus |
| CASP3 (1 of 4) | paralogy | Gasterosteus |
| CASP12 | paralogy | Gorilla |
| CASP2 | paralogy | Horse |
| CASP12 | paralogy | Horse |
| CASP14 | paralogy | Horse |
| CASP4 | paralogy | Horse |
| CASP7 | paralogy | Horse |
| Q3S2Z5_HORSE | paralogy | Horse |
| CASP1_HORSE | paralogy | Horse |
| Caspase-14 | paralogy | Human |
| CASP1 | paralogy | Human |
| CASP10 | paralogy | Human |
| CASP3 | paralogy | Human |
| CASP2 | paralogy | Human |
| CASP4 | paralogy | Human |
| CASP12 | paralogy | Human |
| CASP9 | paralogy | Human |
| CASP3 | paralogy | Lyzard |
| CASP2 | paralogy | Lyzard |
| CASP7 | paralogy | Lyzard |
| CASP14 | paralogy | Lyzard |
| CASP4 | paralogy | Macaca |
| CASP1 | paralogy | Macaca |
| Q8SPU2_MACMU | paralogy | Macaca |
| Q8SPP8_MACMU | paralogy | Macaca |
| CASP12 | paralogy | Macaca |
| CASP14 | paralogy | Macaca |
| CASP10 | paralogy | Macaca |
| CASP9 | paralogy | Macaca |
| Q8JIS9_ORYLA | paralogy | Medaka |
| Q8JIS8_ORYLA | paralogy | Medaka |
| CASP2 | paralogy | Medaka |
| CASP2 | paralogy | Monodelphis |
| CASP9 | paralogy | Monodelphis |
| NP_001033059.1 | paralogy | Monodelphis |
| NP_001033061.1 | paralogy | Monodelphis |
| CASP14 | paralogy | Monodelphis |
| M_domestica_ENSMODP00000034020 | paralogy | Monodelphis |
| M_domestica_ENSMODP00000034022 | paralogy | Monodelphis |
| M_domestica_ENSMODP00000034033 | paralogy | Monodelphis |
| CASP8 | paralogy | Monodelphis |
| Casp12 | paralogy | Mouse |
| Casp1 | paralogy | Mouse |
| Casp9 | paralogy | Mouse |
| Casp2 | paralogy | Mouse |
| Casp3 | paralogy | Mouse |
| Casp7 | paralogy | Mouse |
| CASP9 | paralogy | Orangutan |
| CASP12 | paralogy | Orangutan |
| CASP4 | paralogy | Orangutan |
| CASP1 | paralogy | Orangutan |
| CASP3 | paralogy | Orangutan |
| CASP2 | paralogy | Orangutan |
| CASP3 | paralogy | Ornithorhynchus |
| CASP2 | paralogy | Ornithorhynchus |
| CASP9 | paralogy | Ornithorhynchus |
| O_anatinus_ENSOANP00000016591 | paralogy | Ornithorhynchus |
| CASP1 | paralogy | Rabbit |
| CASP14 | paralogy | Rabbit |
| Casp14_predicted | paralogy | Rat |
| Casp1 | paralogy | Rat |
| Casp3 | paralogy | Rat |
| Casp9 | paralogy | Rat |
| Casp2 | paralogy | Rat |
| Casp12 | paralogy | Rat |
| CASP3 | paralogy | Tetraodon |
| CASP2 | paralogy | Tetraodon |
| CASP6 | paralogy | Tetraodon |
| CASP7 | paralogy | Tetraodon |
| ced-3 | paralogy | Worm |
| CASP2 | paralogy | Xenopus |
| casp7 | paralogy | Xenopus |
| casp6 | paralogy | Xenopus |
| T_guttata_ENSTGUP00000004278 | paralogy | Zebra finch |
| CASP3 | paralogy | Zebra finch |
| T_guttata_ENSTGUP00000011206 | paralogy | Zebra finch |
| T_guttata_ENSTGUP00000013612 | paralogy | Zebra finch |
| CASP9 | paralogy | Zebra finch |
| casp3a | paralogy | Zebrafish |
| LOC563034 | paralogy | Zebrafish |
| casp7 | paralogy | Zebrafish |
| NP_001077331.1 | paralogy | Zebrafish |
| LOC100000522 | paralogy | Zebrafish |
| A2BGE2_DANRE | paralogy | Zebrafish |
| LOC795066 | paralogy | Zebrafish |
| casp2 | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
| GO:0006508 | proteolysis | biological_proccess | TAS |
| GO:0006915 | apoptosis | biological_proccess | IEA |
| GO:0006508 | proteolysis | biological_proccess | IEA |
| GO:0005515 | protein binding | mollecular_function | IEA |
| GO:0005515 | protein binding | mollecular_function | IPI |
| GO:0004197 | cysteine-type endopeptidase activity | mollecular_function | IEA |
| GO:0008233 | peptidase activity | mollecular_function | IEA |
| GO:0008234 | cysteine-type peptidase activity | mollecular_function | IEA |
| GO:0005622 | intracellular | cell_component | IEA |
Check GO Evidence Codes here
Curated Isoforms [+]
Info from The Vertebrate Genome Annotation (VEGA) database.
(*) Canonical transcript and translation forms.
Information from other databases [+]
- Gene info from HGNC [?] :1506
- Gene related info from GeneCards [?] : CASP5
- Ensembl genome browser [?] : ENSG00000137757
- Expression info from Arrayexpress [?] : ENSG00000137757
- Protein expression from Protein Atlas: [?] ENSG00000137757
- Community gene edition from Wikigenes: [?] 838
- OMIM gene information: 602665
- OMIM disease information:
- entrezgene: 838
- refseq_dna: NM_001136111
- refseq_dna: NM_001136110
- refseq_dna: NM_001136109
- refseq_dna: NM_001136112
- refseq_dna: NM_004347
- refseq_dna: NR_024239
- refseq_peptide: NP_001129583
- refseq_peptide: NP_001129582
- refseq_peptide: NP_001129581
- refseq_peptide: NP_004338
- refseq_peptide: NP_001129584
Click on [?] for more information.
