CASP3 (Mus musculus)
Description [+]
- Synonyms: CASP3, CASPASE 3, A830040C14RIK, APOPAIN, CASPASE-3, CC3, CPP32, YAMA
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: caspase 3 Gene [Source:MGI Symbol;Acc:MGI:107739]
- Family: CASPASE
- Process: apoptosis,
- Pathways: extrinsic pathway, intrinsic pathway, post-mitochondrial caspase activation,
- Criteria: manually curated
- Curator comment:
- Human ortholog(s): CASP3
- WIKI: CASP3-M_musculus
References [+]
- Decreased apoptosis in the brain and premature lethality in CPP32-deficient mice.
- Kuida K, Zheng TS, Na S, Kuan C, Yang D, Karasuyama H, Rakic P, Flavell RA
- Programmed cell death (apoptosis) is a prominent feature of the development of the immune and nervous systems. The identification of the Caenorhabditis elegans cell death gene, ced-3, as a prototype of the interleukin-1beta converting enzyme (ICE) protease family has led to extensive evidence implicating these enzymes in apoptosis. Among the ten or more members of the ICE protease family, CPP32/yama/apopain exhibits the highest similarity to CED-3 in both sequence homology and substrate specificity. To analyse its function in vivo, we generated CPP32-deficient mice by homologous recombination. These mice, born at a frequency lower than expected by mendelian genetics, were smaller than their littermates and died at 1-3 weeks of age. Although their thymocytes retained normal susceptibility to various apoptotic stimuli, brain development in CPP32-deficient mice was profoundly affected, and discernible by embryonic day 12, resulting in a variety of hyperplasias and disorganized cell deployment. These supernumerary cells were postmitotic and terminally differentiated by the postnatal stage. Pyknotic clusters at sites of major morphogenetic change during normal brain development were not observed in the mutant embryos, indicating decreased apoptosis in the absence of CPP32. Thus CPP32 is shown to play a critical role during morphogenetic cell death in the mammalian brain. Nature. 1996 Nov 28;384(6607):368-72.
- References from Human ortholog(s):
- CPP32, a novel human apoptotic protein with homology to Caenorhabditis elegans cell death protein Ced-3 and mammalian interleukin-1 beta-converting enzyme.
- Fernandes-Alnemri T, Litwack G, Alnemri ES
- We have cloned a novel apoptotic gene from human Jurkat T-lymphocytes. The new gene encodes a 32-kDa putative cysteine protease (CPP32) with significant homology to Caenorhabditis elegans cell death protein Ced-3, mammalian interleukin-1 beta-converting enzyme (ICE), and the product of the mouse nedd2 gene. The CPP32 transcript is highly expressed and most abundant in cell lines of lymphocytic origin. Overexpression of CPP32 or ICE in Sf9 insect cells resulted in apoptosis. In addition, coexpression of recombinant p20 and p11 derived from the parental full-length CPP32 sequence resulted in apoptosis in Sf9 cells. Our data suggest that similar to ICE, CPP32 is made of two subunits, p20 and p11, which form the active CPP32 complex. The apoptotic activity of CPP32 and its high expression in lymphocytes suggest that CPP32 is an important mediator of apoptosis in the immune system. J Biol Chem. 1994 Dec 9;269(49):30761-4.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | Peptidase_C14 | 45 | 275 |
Protein sequence [+]
Casp3 | Mus musculus | 10090 | length:277
MENNKTSVDSKSINNFEVKTIHGSKSVDSGIYLDSSYKMDYPEMGICIIINNKNFHKSTG
MSSRSGTDVDAANLRETFMGLKYQVRNKNDLTREDILELMDSVSKEDHSKRSSFVCVILS
HGDEGVIYGTNGPVELKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTDE
EMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSMLKLYAHKLEFMHILTRVN
RKVATEFESFSLDSTFHAKKQIPCIVSMLTKELYFYH
MSSRSGTDVDAANLRETFMGLKYQVRNKNDLTREDILELMDSVSKEDHSKRSSFVCVILS
HGDEGVIYGTNGPVELKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTDE
EMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSMLKLYAHKLEFMHILTRVN
RKVATEFESFSLDSTFHAKKQIPCIVSMLTKELYFYH
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:
Explore tree at phylomeDB: Click here.
Homologs list [+]
| Name | Relationship | Species |
|---|---|---|
| A_aegypti_AAEL014348-PA | orthology | Aedes |
| A_aegypti_AAEL003444-PA | orthology | Aedes |
| A_aegypti_AAEL012143-PA | orthology | Aedes |
| A_aegypti_AAEL003439-PA | orthology | Aedes |
| CASPS7 | orthology | Anopheles |
| CASPS14 | orthology | Anopheles |
| CASPS3 | orthology | Anopheles |
| CASPS1 | orthology | Anopheles |
| CASPS11 | orthology | Anopheles |
| CASPS6 | orthology | Anopheles |
| CASPS5 | orthology | Anopheles |
| CASPS8 | orthology | Anopheles |
| CASPS4 | orthology | Anopheles |
| CASPS2 | orthology | Anopheles |
| NP_990056.1 | orthology | Chicken |
| CASP3_PANTR | orthology | Chimpanzee |
| C_intestinalis_ENSCINP00000011503 | orthology | Ciona |
| C_intestinalis_ENSCINP00000028692 | orthology | Ciona |
| C_intestinalis_ENSCINP00000025905 | orthology | Ciona |
| C_intestinalis_ENSCINP00000011493 | orthology | Ciona |
| C_intestinalis_ENSCINP00000025743 | orthology | Ciona |
| CASP3_BOVIN | orthology | Cow |
| CASP3_CANFA | orthology | Dog |
| decay | orthology | Fly |
| Ice | orthology | Fly |
| Dcp-1 | orthology | Fly |
| NP_001027871.1 | orthology | Fugu |
| CASP3 (3 of 4) | orthology | Gasterosteus |
| CASP3 (2 of 4) | orthology | Gasterosteus |
| CASP3 (1 of 4) | orthology | Gasterosteus |
| CASP3 (4 of 4) | orthology | Gasterosteus |
| Q3S2Z5_HORSE | orthology | Horse |
| CASP3 | orthology | Human |
| CASP3 | orthology | Lyzard |
| Q8SPU2_MACMU | orthology | Macaca |
| M_mulatta_ENSMMUP00000033547 | orthology | Macaca |
| Q8JIS8_ORYLA | orthology | Medaka |
| Q8JIS9_ORYLA | orthology | Medaka |
| M_domestica_ENSMODP00000005512 | orthology | Monodelphis |
| NP_001033059.1 | orthology | Monodelphis |
| NP_001033061.1 | orthology | Monodelphis |
| CASP3 | orthology | Orangutan |
| CASP3 | orthology | Ornithorhynchus |
| CASP3 | orthology | Rabbit |
| R_norvegicus_ENSRNOP00000040783 | orthology | Rat |
| CASP3 | orthology | Tetraodon |
| ced-3 | orthology | Worm |
| CASP3 | orthology | Xenopus |
| CASP3 | orthology | Zebra finch |
| casp3b | orthology | Zebrafish |
| casp3a | orthology | Zebrafish |
| NP_990057.1 | paralogy | Chicken |
| CASP7 | paralogy | Chicken |
| NP_001038154.1 | paralogy | Chicken |
| CASP10 | paralogy | Chicken |
| NP_989923.1 | paralogy | Chicken |
| Q90WU0_CHICK | paralogy | Chicken |
| CASP9 | paralogy | Chimpanzee |
| CASP8 | paralogy | Chimpanzee |
| CASP7 | paralogy | Chimpanzee |
| CASP6 | paralogy | Chimpanzee |
| C_intestinalis_ENSCINP00000003204 | paralogy | Ciona |
| C_intestinalis_ENSCINP00000024485 | paralogy | Ciona |
| CASP6_BOVIN | paralogy | Cow |
| IPI00689801.3 | paralogy | Cow |
| IPI00704513.4 | paralogy | Cow |
| NP_001039435.1 | paralogy | Cow |
| Q38JA9_CANFA | paralogy | Dog |
| Q45T68_CANFA | paralogy | Dog |
| CASP10 | paralogy | Dog |
| CASP6 | paralogy | Dog |
| CASP7 | paralogy | Dog |
| CASP7 | paralogy | Fugu |
| CASP6 | paralogy | Fugu |
| T_rubripes_ENSTRUP00000044662 | paralogy | Fugu |
| CASP9 | paralogy | Fugu |
| CASP2 | paralogy | Gasterosteus |
| CASP6 | paralogy | Gasterosteus |
| CASP9 | paralogy | Gasterosteus |
| CASP7 | paralogy | Gasterosteus |
| G_aculeatus_ENSGACP00000005791 | paralogy | Gasterosteus |
| CASP7 | paralogy | Gorilla |
| CASP9 | paralogy | Gorilla |
| CASP8 | paralogy | Gorilla |
| CASP8 | paralogy | Horse |
| CASP10 | paralogy | Horse |
| CASP7 | paralogy | Horse |
| CASP6 | paralogy | Horse |
| CASP9 | paralogy | Horse |
| CASP10 | paralogy | Human |
| CASP8 | paralogy | Human |
| CASP6 | paralogy | Human |
| CASP7 | paralogy | Human |
| CASP9 | paralogy | Human |
| CASP6 | paralogy | Lyzard |
| CASP7 | paralogy | Lyzard |
| CASP9 | paralogy | Macaca |
| CASP8 | paralogy | Macaca |
| CASP7 | paralogy | Macaca |
| CASP2 | paralogy | Medaka |
| CASP9 | paralogy | Medaka |
| CASP7 | paralogy | Medaka |
| CASP8 | paralogy | Monodelphis |
| CASP9 | paralogy | Monodelphis |
| CASP6 | paralogy | Monodelphis |
| CASP7 | paralogy | Monodelphis |
| Casp8 | paralogy | Mouse |
| Casp6 | paralogy | Mouse |
| Casp9 | paralogy | Mouse |
| Casp7 | paralogy | Mouse |
| CASP7 | paralogy | Orangutan |
| CASP6 | paralogy | Orangutan |
| CASP9 | paralogy | Orangutan |
| Q5RCR7_PONPY | paralogy | Orangutan |
| CASP9 | paralogy | Ornithorhynchus |
| CASP10 | paralogy | Ornithorhynchus |
| CASP7 | paralogy | Ornithorhynchus |
| CASP6 | paralogy | Ornithorhynchus |
| CASP8 | paralogy | Ornithorhynchus |
| CASP10 | paralogy | Rabbit |
| CASP7 | paralogy | Rabbit |
| CASP8 | paralogy | Rabbit |
| CASP6 | paralogy | Rabbit |
| Casp7 | paralogy | Rat |
| Casp8 | paralogy | Rat |
| Casp3 | paralogy | Rat |
| Casp9 | paralogy | Rat |
| Casp6 | paralogy | Rat |
| CASP6 | paralogy | Tetraodon |
| T_nigroviridis_ENSTNIP00000001216 | paralogy | Tetraodon |
| CASP9 | paralogy | Tetraodon |
| CASP7 | paralogy | Tetraodon |
| casp7 | paralogy | Xenopus |
| casp10 | paralogy | Xenopus |
| casp6 | paralogy | Xenopus |
| CASP8 | paralogy | Zebra finch |
| T_guttata_ENSTGUP00000011206 | paralogy | Zebra finch |
| CASP9 | paralogy | Zebra finch |
| T_guttata_ENSTGUP00000004278 | paralogy | Zebra finch |
| T_guttata_ENSTGUP00000014729 | paralogy | Zebra finch |
| D_rerio_ENSDARP00000047019 | paralogy | Zebrafish |
| casp6l1 | paralogy | Zebrafish |
| casp8l2 | paralogy | Zebrafish |
| LOC100000522 | paralogy | Zebrafish |
| casp6 | paralogy | Zebrafish |
| A2BGE2_DANRE | paralogy | Zebrafish |
| casp7 | paralogy | Zebrafish |
| casp6l2 | paralogy | Zebrafish |
| casp8l1 | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0001782 | B cell homeostasis | biological_proccess | IMP |
| GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IGI |
| GO:0006309 | DNA fragmentation during apoptosis | biological_proccess | IMP |
| GO:0006508 | proteolysis | biological_proccess | RCA |
| GO:0006917 | induction of apoptosis | biological_proccess | IMP |
| GO:0006974 | response to DNA damage stimulus | biological_proccess | IDA |
| GO:0007507 | heart development | biological_proccess | IGI |
| GO:0007605 | sensory perception of sound | biological_proccess | IMP |
| GO:0008625 | induction of apoptosis via death domain receptors | biological_proccess | IMP |
| GO:0008631 | induction of apoptosis by oxidative stress | biological_proccess | IDA |
| GO:0009411 | response to UV | biological_proccess | IGI |
| GO:0009611 | response to wounding | biological_proccess | IDA |
| GO:0030216 | keratinocyte differentiation | biological_proccess | IMP |
| GO:0030889 | negative regulation of B cell proliferation | biological_proccess | IMP |
| GO:0043029 | T cell homeostasis | biological_proccess | IMP |
| GO:0045165 | cell fate commitment | biological_proccess | IMP |
| GO:0045736 | negative regulation of cyclin-dependent protein kinase activity | biological_proccess | IMP |
| GO:0046007 | negative regulation of activated T cell proliferation | biological_proccess | IMP |
| GO:0051402 | neuron apoptosis | biological_proccess | IDA |
| GO:0006915 | apoptosis | biological_proccess | IMP |
| GO:0045786 | negative regulation of cell cycle | biological_proccess | IMP |
| GO:0043066 | negative regulation of apoptosis | biological_proccess | ISO |
| GO:0043066 | negative regulation of apoptosis | biological_proccess | IEA |
| GO:0006508 | proteolysis | biological_proccess | IEA |
| GO:0030264 | nuclear fragmentation during apoptosis | biological_proccess | IEA |
| GO:0004197 | cysteine-type endopeptidase activity | mollecular_function | IEA |
| GO:0004861 | cyclin-dependent protein kinase inhibitor activity | mollecular_function | IMP |
| GO:0005515 | protein binding | mollecular_function | IPI |
| GO:0008233 | peptidase activity | mollecular_function | RCA |
| GO:0016787 | hydrolase activity | mollecular_function | IEA |
| GO:0008234 | cysteine-type peptidase activity | mollecular_function | IDA |
| GO:0005515 | protein binding | mollecular_function | IEA |
| GO:0008233 | peptidase activity | mollecular_function | IEA |
| GO:0005737 | cytoplasm | cell_component | IDA |
| GO:0005634 | nucleus | cell_component | IEA |
| GO:0005829 | cytosol | cell_component | IEA |
| GO:0005739 | mitochondrion | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from MGI [?] MGI:107739
- Ensembl genome browser [?] : ENSMUSG00000031628
- Expression info from Arrayexpress [?] : ENSMUSG00000031628
- Protein expression from Protein Atlas: [?] ENSMUSG00000031628
- Community gene edition from Wikigenes: [?] 12367
Click on [?] for more information.
