CASP12 (Pongo pygmaeus)
Description [+]
- Synonyms: CASP12
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Pongo pygmaeus
- Short gene description: Inactive caspase-12 (CASP-12) [Source:UniProtKB/Swiss-Prot;Acc:Q6UXS9]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CASP12-P_pygmaeus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | CARD | 4 | 91 |
| PFAM A | Peptidase_C14 | 100 | 337 |
Protein sequence [+]
CASP12 | Pongo pygmaeus | 9600 | length:341
FTDEKPSNGVPVHMVKLLIRTFLDGIFDDLMENNVLNTDEIHLIGTCLKFVVSNAENLVD
DITQTAQIAGKIFREHLWNSKKQLSSDISSDGERGPNTPGLIICNKEFNYLHNRNGSELD
LLGMQDLLENLGYSVVIKENLTAQEMETALRQFAARPEHQTSDSTFLVFMSHGILNGICG
TKHWDQEPDVLHDDTIFEIFNNRNCRSLKDKPKVIIMQACRGNGAGIVWFTIDSGKASAD
THGRLLQGNICNDAVTKAHVEKDFIAFKSSTPHNVSWRHEINGSVFISQIIYYFKEYSWS
HHLEEIFRKVQHSFENPSILTQLPTIERLSMTRYFYLFPGN
DITQTAQIAGKIFREHLWNSKKQLSSDISSDGERGPNTPGLIICNKEFNYLHNRNGSELD
LLGMQDLLENLGYSVVIKENLTAQEMETALRQFAARPEHQTSDSTFLVFMSHGILNGICG
TKHWDQEPDVLHDDTIFEIFNNRNCRSLKDKPKVIIMQACRGNGAGIVWFTIDSGKASAD
THGRLLQGNICNDAVTKAHVEKDFIAFKSSTPHNVSWRHEINGSVFISQIIYYFKEYSWS
HHLEEIFRKVQHSFENPSILTQLPTIERLSMTRYFYLFPGN
Structure links:
Evolution [+]
Explore tree at phylomeDB: Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0006508 | proteolysis | biological_proccess | IEA |
| GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
| GO:0006915 | apoptosis | biological_proccess | IEA |
| GO:0030968 | endoplasmic reticulum unfolded protein response | biological_proccess | IEA |
| GO:0006926 | virus-infected cell apoptosis | biological_proccess | IEA |
| GO:0070059 | apoptosis in response to endoplasmic reticulum stress | biological_proccess | IEA |
| GO:0005515 | protein binding | mollecular_function | IEA |
| GO:0008234 | cysteine-type peptidase activity | mollecular_function | IEA |
| GO:0005622 | intracellular | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSPPYG00000003823
- Expression info from Arrayexpress [?] : ENSPPYG00000003823
- Protein expression from Protein Atlas: [?] ENSPPYG00000003823
Click on [?] for more information.
