NP_990056.1 (Gallus gallus)
Description [+]
- Synonyms: NP_990056.1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Aves; Gallus gallus
- Short gene description: caspase 3 [Source:RefSeq_peptide;Acc:NP_990056]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NP_990056.1-G_gallus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Peptidase_C14 | 53 | 281 |
Protein sequence [+]
NP_990056.1 | Gallus gallus | 9031 | length:283
MMTDIKDGPRSGEDVSDARSFPGSKGMNLPASKSVDSGILPDDSYRMDYPEIGVCVIINN
KNFHRDTGLSSRSGTDADAASVREVFMKLGYKVKLNNDLSSRDIFKLLKNVSEEDHSKRS
SFVCVLLSHGDEGLFYGTDGPLELKVLTSLFRGDKCRSLAGKPKLFFIQACRGTELDSGI
EADSGPDETVCQKIPVEADFLYAYSTAPGYYSWRNAAEGSWFIQSLCRMLKEHARKLELM
QILTRVNRRVAEYESCSTRQDFNAKKQIPCIVSMLTKEFYFPC
KNFHRDTGLSSRSGTDADAASVREVFMKLGYKVKLNNDLSSRDIFKLLKNVSEEDHSKRS
SFVCVLLSHGDEGLFYGTDGPLELKVLTSLFRGDKCRSLAGKPKLFFIQACRGTELDSGI
EADSGPDETVCQKIPVEADFLYAYSTAPGYYSWRNAAEGSWFIQSLCRMLKEHARKLELM
QILTRVNRRVAEYESCSTRQDFNAKKQIPCIVSMLTKEFYFPC
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0001782 | B cell homeostasis | biological_proccess | IEA |
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IEA |
GO:0006309 | DNA fragmentation during apoptosis | biological_proccess | IEA |
GO:0006508 | proteolysis | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006974 | response to DNA damage stimulus | biological_proccess | IEA |
GO:0007507 | heart development | biological_proccess | IEA |
GO:0007605 | sensory perception of sound | biological_proccess | IEA |
GO:0008625 | induction of apoptosis via death domain receptors | biological_proccess | IEA |
GO:0008631 | induction of apoptosis by oxidative stress | biological_proccess | IEA |
GO:0009411 | response to UV | biological_proccess | IEA |
GO:0009611 | response to wounding | biological_proccess | IEA |
GO:0030216 | keratinocyte differentiation | biological_proccess | IEA |
GO:0030889 | negative regulation of B cell proliferation | biological_proccess | IEA |
GO:0043029 | T cell homeostasis | biological_proccess | IEA |
GO:0045165 | cell fate commitment | biological_proccess | IEA |
GO:0045736 | negative regulation of cyclin-dependent protein kinase activity | biological_proccess | IEA |
GO:0045786 | negative regulation of cell cycle | biological_proccess | IEA |
GO:0046007 | negative regulation of activated T cell proliferation | biological_proccess | IEA |
GO:0051402 | neuron apoptosis | biological_proccess | IEA |
GO:0006954 | inflammatory response | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IEA |
GO:0030264 | nuclear fragmentation during apoptosis | biological_proccess | IEA |
GO:0004197 | cysteine-type endopeptidase activity | mollecular_function | IEA |
GO:0004861 | cyclin-dependent protein kinase inhibitor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0008233 | peptidase activity | mollecular_function | IEA |
GO:0008234 | cysteine-type peptidase activity | mollecular_function | IEA |
GO:0016787 | hydrolase activity | mollecular_function | IEA |
GO:0005149 | interleukin-1 receptor binding | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSGALG00000010638
- Expression info from Arrayexpress [?] : ENSGALG00000010638
- Protein expression from Protein Atlas: [?] ENSGALG00000010638
Click on [?] for more information.