CASP9 (Mus musculus)
Description [+]
- Synonyms: CASP9, CASPASE 9, CASPASE-9, ICE-LAP6, MCH6
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: caspase 9 [Source:RefSeq peptide;Acc:NP_056548]
- Family: CASPASE
- Process: apoptosis,
- Pathways: intrinsic pathway, post-mitochondrial caspase activation,
- Criteria: manually curated
- Curator comment:
- WIKI: CASP9-M_musculus
References [+]
- Reduced apoptosis and cytochrome c-mediated caspase activation in mice lacking caspase 9.
- Kuida K, Haydar TF, Kuan CY, Gu Y, Taya C, Karasuyama H, Su MS, Rakic P, Flavell RA
- Caspases are essential components of the mammalian cell death machinery. Here we test the hypothesis that Caspase 9 (Casp9) is a critical upstream activator of caspases through gene targeting in mice. The majority of Casp9 knockout mice die perinatally with a markedly enlarged and malformed cerebrum caused by reduced apoptosis during brain development. Casp9 deletion prevents activation of Casp3 in embryonic brains in vivo, and Casp9-deficient thymocytes show resistance to a subset of apoptotic stimuli, including absence of Casp3-like cleavage and delayed DNA fragmentation. Moreover, the cytochrome c-mediated cleavage of Casp3 is absent in the cytosolic extracts of Casp9-deficient cells but is restored after addition of in vitro-translated Casp9. Together, these results indicate that Casp9 is a critical upstream activator of the caspase cascade in vivo. Cell. 1998 Aug 7;94(3):325-37.
- Differential requirement for caspase 9 in apoptotic pathways in vivo.
- Hakem R, Hakem A, Duncan GS, Henderson JT, Woo M, Soengas MS, Elia A, de la Pompa JL, Kagi D, Khoo W, Potter J, Yoshida R, Kaufman SA, Lowe SW, Penninger JM, Mak TW
- Mutation of Caspase 9 (Casp9) results in embryonic lethality and defective brain development associated with decreased apoptosis. Casp9-/- embryonic stem cells and embryonic fibroblasts are resistant to several apoptotic stimuli, including UV and gamma irradiation. Casp9-/- thymocytes are also resistant to dexamethasone- and gamma irradiation-induced apoptosis, but are surprisingly sensitive to apoptosis induced by UV irradiation or anti-CD95. Resistance to apoptosis is accompanied by retention of the mitochondrial membrane potential in mutant cells. In addition, cytochrome c is translocated to the cytosol of Casp9-/- ES cells upon UV stimulation, suggesting that Casp9 acts downstream of cytochrome c. Caspase processing is inhibited in Casp9-/- ES cells but not in thymocytes or splenocytes. Comparison of the requirement for Casp9 and Casp3 in different apoptotic settings indicates the existence of at least four different apoptotic pathways in mammalian cells. Cell. 1998 Aug 7;94(3):339-52.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | CARD | 6 | 92 |
PFAM A | Peptidase_C14 | 199 | 451 |
Protein sequence [+]
Casp9 | Mus musculus | 10090 | length:454
MDEADRQLLRRCRVRLVSELQVAELWDALLSRELFTRDMIEDIQQAGSGSRRDQARQLVT
DLETRGRQALPLFISCLEDTGQGTLASLLQSGRQAAKQDPEAVKPLDHLVPVVLGPMGLT
AKEQRVVKLDPSQPAVGNLTPVVLGPEELWPARLKPEVLRPETPRPVDIGSGGAHDVCVP
GKIRGHADMAYTLDSDPCGHCLIINNVNFCPSSGLGTRTGSNLDRDKLEHRFRWLRFMVE
VKNDLTAKKMVTALMEMAHRNHRALDCFVVVILSHGCQASHLQFPGAVYGTDGCSVSIEK
IVNIFNGSGCPSLGGKPKLFFIQACGGEQKDHGFEVACTSSQGRTLDSDSEPDAVPYQEG
PRPLDQLDAVSSLPTPSDILVSYSTFPGFVSWRDKKSGSWYIETLDGILEQWARSEDLQS
LLLRVANAVSAKGTYKQIPGCFNFLRKKLFFKTS
DLETRGRQALPLFISCLEDTGQGTLASLLQSGRQAAKQDPEAVKPLDHLVPVVLGPMGLT
AKEQRVVKLDPSQPAVGNLTPVVLGPEELWPARLKPEVLRPETPRPVDIGSGGAHDVCVP
GKIRGHADMAYTLDSDPCGHCLIINNVNFCPSSGLGTRTGSNLDRDKLEHRFRWLRFMVE
VKNDLTAKKMVTALMEMAHRNHRALDCFVVVILSHGCQASHLQFPGAVYGTDGCSVSIEK
IVNIFNGSGCPSLGGKPKLFFIQACGGEQKDHGFEVACTSSQGRTLDSDSEPDAVPYQEG
PRPLDQLDAVSSLPTPSDILVSYSTFPGFVSWRDKKSGSWYIETLDGILEQWARSEDLQS
LLLRVANAVSAKGTYKQIPGCFNFLRKKLFFKTS
Structure links:
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006508 | proteolysis | biological_proccess | RCA |
GO:0006917 | induction of apoptosis | biological_proccess | RCA |
GO:0006919 | activation of caspase activity | biological_proccess | IMP |
GO:0006974 | response to DNA damage stimulus | biological_proccess | IMP |
GO:0009411 | response to UV | biological_proccess | IMP |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0043525 | positive regulation of neuron apoptosis | biological_proccess | IMP |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0004197 | cysteine-type endopeptidase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0008233 | peptidase activity | mollecular_function | RCA |
GO:0008234 | cysteine-type peptidase activity | mollecular_function | IEA |
GO:0042277 | peptide binding | mollecular_function | IEA |
GO:0005622 | intracellular | cell_component | IEA |
GO:0005625 | soluble fraction | cell_component | IDA |
GO:0005634 | nucleus | cell_component | IDA |
GO:0005829 | cytosol | cell_component | IDA |
GO:0005737 | cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
Curated Isoforms [+]
Transcript | Translation |
---|---|
OTTMUST00000023070 * | OTTMUSP00000010525 * |
OTTMUST00000023071 | |
OTTMUST00000023072 | OTTMUSP00000010526 |
OTTMUST00000023219 | OTTMUSP00000010606 |
OTTMUST00000023220 | |
OTTMUST00000023224 |
Info from The Vertebrate Genome Annotation (VEGA) database.
(*) Canonical transcript and translation forms.
Information from other databases [+]
- Gene info from MGI [?] MGI:1277950
- Ensembl genome browser [?] : ENSMUSG00000028914
- Expression info from Arrayexpress [?] : ENSMUSG00000028914
- Protein expression from Protein Atlas: [?] ENSMUSG00000028914
- Community gene edition from Wikigenes: [?] 12371
Click on [?] for more information.