Q90WU0_CHICK (Gallus gallus)
Description [+]
- Synonyms: Q90WU0_CHICK
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Aves; Gallus gallus
- Short gene description: Caspase 9 (Fragment). [Source:UniProtKB/TrEMBL;Acc:Q90WU0]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: Q90WU0_CHICK-G_gallus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | CARD | 6 | 90 |
PFAM A | Peptidase_C14 | 164 | 416 |
Protein sequence [+]
Q90WU0_CHICK | Gallus gallus | 9031 | length:419
MEEAQRSALRRGRVRLVEGLRPEVLWGPLQARGVFTSAMVEDMQSTGTRREQARQLVIDL
ETRGKQAFPIFLSILRDTGHGDLADMLDEGCGSPMSPPVDLRPVQLELPGERRDKSVSTA
ERLSIPVQPESERFRMPPAPAQACPTGLAGECSEVYQLRADPCGHCLIFNNVSFSRDSDL
STRAGSDIDCEKLEKRFRSLCFHVRTLRNLKAQEIDVELRKLARLDHSALDCCLVVILSH
GCQTSHIQFPGGIYGTDGKIIPIERIVNYFNGSQCPSLRGKPKLFFIQACGGEQKDQGFE
VDCESPQDETCRRSIESDAIPFQAPSGNEDEPDAVASLPTPGDILVSYSTFPGFVSWRDK
VSGSWYVETLDSVLEHYARSEDLLTMLLRVSDIVSTKGRYKQIPGCFNFLRKKFFFLCK
ETRGKQAFPIFLSILRDTGHGDLADMLDEGCGSPMSPPVDLRPVQLELPGERRDKSVSTA
ERLSIPVQPESERFRMPPAPAQACPTGLAGECSEVYQLRADPCGHCLIFNNVSFSRDSDL
STRAGSDIDCEKLEKRFRSLCFHVRTLRNLKAQEIDVELRKLARLDHSALDCCLVVILSH
GCQTSHIQFPGGIYGTDGKIIPIERIVNYFNGSQCPSLRGKPKLFFIQACGGEQKDQGFE
VDCESPQDETCRRSIESDAIPFQAPSGNEDEPDAVASLPTPGDILVSYSTFPGFVSWRDK
VSGSWYVETLDSVLEHYARSEDLLTMLLRVSDIVSTKGRYKQIPGCFNFLRKKFFFLCK
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006508 | proteolysis | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006974 | response to DNA damage stimulus | biological_proccess | IEA |
GO:0006919 | activation of caspase activity | biological_proccess | IEA |
GO:0043525 | positive regulation of neuron apoptosis | biological_proccess | IEA |
GO:0009411 | response to UV | biological_proccess | IEA |
GO:0004197 | cysteine-type endopeptidase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0008234 | cysteine-type peptidase activity | mollecular_function | IEA |
GO:0008233 | peptidase activity | mollecular_function | IEA |
GO:0016787 | hydrolase activity | mollecular_function | IEA |
GO:0005622 | intracellular | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0005625 | soluble fraction | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSGALG00000001366
- Expression info from Arrayexpress [?] : ENSGALG00000001366
- Protein expression from Protein Atlas: [?] ENSGALG00000001366
- entrezgene: 426970
Click on [?] for more information.