CASP1 (Macaca mulatta)
Description [+]
- Synonyms: CASP1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Cercopithecidae; Macaca mulatta
- Short gene description: Caspase-1 Precursor (CASP-1)(EC 3.4.22.36)(Interleukin-1 beta convertase)(IL-1BC)(Interleukin-1 beta-converting enzyme)(IL-1 beta-converting enzyme)(ICE)(p45) [Contains Caspase-1 subunit p20;Caspase-1 subunit p10] [Source:UniProtKB/Swiss-Prot;Acc:P29466]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CASP1-M_mulatta
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Peptidase_C14 | 69 | 258 |
Protein sequence [+]
CASP1 | Macaca mulatta | 9544 | length:262
TDKVLKEKRKLFIHSMGEASLAMQDNPAMPTSSGSKGNVKLCSQEEAQRIWKEKPAEIYP
IMVKSGRTRLALIICNEEFDTLPRRTGAEVDITGMTMLLQNLGYSVDVRKNLMASEMTTE
LEAFAHRPEHKTSDSAFLVFMSHGIREGICGKKYSEQVPDVLQLNVIFEMLNTRNCPSLK
DKPKVIIIQACRGDNVSWRHPTKGSVFIIRLIEHIQEYACSCDVEEIFRKVRLSFEQPSG
RVQMPTTERVTLTRCFYLFPGH
IMVKSGRTRLALIICNEEFDTLPRRTGAEVDITGMTMLLQNLGYSVDVRKNLMASEMTTE
LEAFAHRPEHKTSDSAFLVFMSHGIREGICGKKYSEQVPDVLQLNVIFEMLNTRNCPSLK
DKPKVIIIQACRGDNVSWRHPTKGSVFIIRLIEHIQEYACSCDVEEIFRKVRLSFEQPSG
RVQMPTTERVTLTRCFYLFPGH
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006508 | proteolysis | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0050718 | positive regulation of interleukin-1 beta secretion | biological_proccess | IEA |
GO:0008219 | cell death | biological_proccess | IEA |
GO:0001666 | response to hypoxia | biological_proccess | IEA |
GO:0016485 | protein processing | biological_proccess | IEA |
GO:0042221 | response to chemical stimulus | biological_proccess | IEA |
GO:0033198 | response to ATP | biological_proccess | IEA |
GO:0050715 | positive regulation of cytokine secretion | biological_proccess | IEA |
GO:0050717 | positive regulation of interleukin-1 alpha secretion | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0004197 | cysteine-type endopeptidase activity | mollecular_function | IEA |
GO:0008234 | cysteine-type peptidase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0008233 | peptidase activity | mollecular_function | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005622 | intracellular | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSMMUG00000009852
- Expression info from Arrayexpress [?] : ENSMMUG00000009852
- Protein expression from Protein Atlas: [?] ENSMMUG00000009852
Click on [?] for more information.