Q3S2Z5_HORSE (Equus caballus)
Description [+]
- Synonyms: Q3S2Z5_HORSE
- Species: Equus caballus
- Short gene description: Caspase-3 (Fragment). [Source:UniProtKB/TrEMBL;Acc:Q3S2Z5]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: Q3S2Z5_HORSE-E_caballus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Peptidase_C14 | 45 | 275 |
Protein sequence [+]
Q3S2Z5_HORSE | Equus caballus | 9796 | length:277
MENSKISVDSKSIKNSETKILHGSKSMDSGISLDSSYKMDYPEMGLCIIINNKNFHKSTG
MASRSGTDVDAANLRETFTNLKYEVRNKNDLTGEEIVALMRSVSKEDHSKRSSFICVLLS
HGEEGIIFGTNGPIDLKKLTCFFKGDCCRSLAGKPKLFIIQACRGTELDSGIETDSGIED
DMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKLYAHKLELMHILTRVN
RKVAMEFESYCLDPTFHGKKQIPCIVSMLTKELYFYH
MASRSGTDVDAANLRETFTNLKYEVRNKNDLTGEEIVALMRSVSKEDHSKRSSFICVLLS
HGEEGIIFGTNGPIDLKKLTCFFKGDCCRSLAGKPKLFIIQACRGTELDSGIETDSGIED
DMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKLYAHKLELMHILTRVN
RKVAMEFESYCLDPTFHGKKQIPCIVSMLTKELYFYH
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0001782 | B cell homeostasis | biological_proccess | IEA |
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IEA |
GO:0006309 | DNA fragmentation during apoptosis | biological_proccess | IEA |
GO:0006508 | proteolysis | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006974 | response to DNA damage stimulus | biological_proccess | IEA |
GO:0007507 | heart development | biological_proccess | IEA |
GO:0007605 | sensory perception of sound | biological_proccess | IEA |
GO:0008625 | induction of apoptosis via death domain receptors | biological_proccess | IEA |
GO:0008631 | induction of apoptosis by oxidative stress | biological_proccess | IEA |
GO:0009411 | response to UV | biological_proccess | IEA |
GO:0009611 | response to wounding | biological_proccess | IEA |
GO:0030216 | keratinocyte differentiation | biological_proccess | IEA |
GO:0030264 | nuclear fragmentation during apoptosis | biological_proccess | IEA |
GO:0030889 | negative regulation of B cell proliferation | biological_proccess | IEA |
GO:0043029 | T cell homeostasis | biological_proccess | IEA |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IEA |
GO:0045165 | cell fate commitment | biological_proccess | IEA |
GO:0045736 | negative regulation of cyclin-dependent protein kinase activity | biological_proccess | IEA |
GO:0045786 | negative regulation of cell cycle | biological_proccess | IEA |
GO:0046007 | negative regulation of activated T cell proliferation | biological_proccess | IEA |
GO:0051402 | neuron apoptosis | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0004197 | cysteine-type endopeptidase activity | mollecular_function | IEA |
GO:0004861 | cyclin-dependent protein kinase inhibitor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0008233 | peptidase activity | mollecular_function | IEA |
GO:0008234 | cysteine-type peptidase activity | mollecular_function | IEA |
GO:0016787 | hydrolase activity | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSECAG00000022197
- Expression info from Arrayexpress [?] : ENSECAG00000022197
- Protein expression from Protein Atlas: [?] ENSECAG00000022197
- Community gene edition from Wikigenes: [?] 100034083
- entrezgene: 100034083
Click on [?] for more information.