BCL2 (Homo sapiens)
Description [+]
- Synonyms: BCL2, BCL-2
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Apoptosis regulator Bcl-2 [Source:UniProtKB/Swiss-Prot;Acc:P10415]
- Family: Bcl-2 family : multidomain Bcl-2
- Process: apoptosis,
- Pathways: intrinsic pathway, pre-mitochondrial signaling events,
- Criteria: manually curated
- Curator comment:
- Mouse ortholog(s): Bcl2
- WIKI: BCL2-H_sapiens
References [+]
- Oncogenic potential of bcl-2 demonstrated by gene transfer.
- Reed JC, Cuddy M, Slabiak T, Croce CM, Nowell PC
- Follicular lymphoma is the most common human B-cell malignancy in the United States and Western Europe. Most of the tumours contain t(14;18) chromosome translocations involving the human bcl-2 gene. Translocation of bcl-2 sequences from chromosome 18 into the transcriptionally active immunoglobulin locus at chromosome band 14q32 in B cells deregulates bcl-2 gene expression, resulting in the accumulation of high levels of bcl-2 messenger. Human bcl-2 transcripts generate two proteins, p26 bcl-2-alpha and p22 bcl-2-beta, by virtue of alternative splice-site selection. Both proteins have in common their first 196 NH2-terminal amino acids but share little similarity with other sequences in a data bank. Although the biological and biochemical functions of bcl-2 are unknown, recent subcellular localization studies indicate that p26 bcl-2-alpha associates with cellular membranes, consistent with a stretch of hydrophobic amino acids in its carboxy terminus. The bcl-2 gene may represent a novel oncogene having no known retroviral counterpart. Here we demonstrate the oncogenic potential of bcl-2 through a gene transfer approach. Nature. 1988 Nov 17;336(6196):259-61.
- References from Mouse ortholog(s):
- Molecular analysis of mbcl-2: structure and expression of the murine gene homologous to the human gene involved in follicular lymphoma.
- Negrini M, Silini E, Kozak C, Tsujimoto Y, Croce CM
- We have cloned the mouse bcl-2 (mbcl-2) genomic locus and analyzed it in detail. The gene is comprised of two exons separated by more than 15 kb. Two species of mRNAs are produced, and DNA sequencing analysis shows that they code for two proteins differing at their C terminus: a 7.5 kb transcript codes for a polypeptide of 236 amino acids, mbcl-2 alpha, and a 2.4 kb transcript, which derives from the 5' exon only, codes for a protein of 199 amino acids, mbcl-2 beta. The gene is characterized by very long (5' about 1.4 kb, and 3' about 5.1 kb) untranslated regions surrounding the relatively short coding region. We have mapped the 5' end of the mbcl-2 mRNAs by S1 protection analysis, and we have analyzed the promoter region. The expression of the mbcl-2 gene was analyzed in different cell lines and in mouse tissues. Expression is tissue-specific in adult tissues: spleen and thymus express the highest level of mbcl-2 transcripts. The mbcl-2 gene maps to mouse chromosome 1. Cell. 1987 May 22;49(4):455-63.
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | BH4 | 7 | 33 |
PFAM A | Bcl-2 | 97 | 195 |
Protein sequence [+]
BCL2 | Homo sapiens | 9606 | length:239
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Structure links:
- Smartdomain prediction information: SM00265
- Smartdomain prediction information: SM00337
- Prosite motif and domain information: PS01080
- Prosite motif and domain information: PS01258
- Prosite motif and domain information: PS01259
- Prosite motif and domain information: PS01260
- Profile motif and domain profile information: PS50062
- Profile motif and domain profile information: PS50063
- Interpro domain information: P10415
- PFAM domain and domain family information: P10415
- Protein 3D structures from PDB: 1GJH 1YSW 2O21 2O22 2O2F 1G5M
Evolution [+]
View protein alignment and tree with Jalview:  
Explore tree at phylomeDB:   Click here.
Homologs list [+]
Name | Relationship | Species |
---|---|---|
BCL2_CHICK | orthology | Chicken |
BCL2 | orthology | Chimpanzee |
Q462R3_BOVIN | orthology | Cow |
BCL2 | orthology | Dog |
BCL2 | orthology | Fugu |
BCL2 | orthology | Gasterosteus |
BCL2 | orthology | Gorilla |
BCL2 | orthology | Horse |
BCL2 | orthology | Lyzard |
BCL2 | orthology | Macaca |
BCL2 | orthology | Medaka |
BCL2 | orthology | Monodelphis |
Bcl2 | orthology | Mouse |
BCL2 | orthology | Orangutan |
Bcl2 | orthology | Rat |
BCL2 | orthology | Tetraodon |
BCL2 | orthology | Xenopus |
BCL2 | orthology | Zebra finch |
bcl2 | orthology | Zebrafish |
A_aegypti_AAEL001515-PA | paralogy | Aedes |
A_aegypti_AAEL001521-PA | paralogy | Aedes |
Q2PHG8_ANOGA | paralogy | Anopheles |
NP_001026091.1 | paralogy | Chicken |
BCLX_CHICK | paralogy | Chicken |
MCL1 | paralogy | Chimpanzee |
BCL2L2 | paralogy | Chimpanzee |
BAX | paralogy | Chimpanzee |
BCL2L1 | paralogy | Chimpanzee |
XR_024448.1 | paralogy | Chimpanzee |
C_intestinalis_ENSCINP00000000654 | paralogy | Ciona |
C_intestinalis_ENSCINP00000019812 | paralogy | Ciona |
C_intestinalis_ENSCINP00000024813 | paralogy | Ciona |
NP_001071386.1 | paralogy | Cow |
NP_001070954.1 | paralogy | Cow |
NP_001092676.1 | paralogy | Cow |
BCLW_BOVIN | paralogy | Cow |
IPI00908204.1 | paralogy | Cow |
NP_001018644.1 | paralogy | Dog |
NP_001003072.1 | paralogy | Dog |
MCL1_CANFA | paralogy | Dog |
BCL2A1 | paralogy | Dog |
debcl | paralogy | Fly |
Buffy | paralogy | Fly |
MCL1 | paralogy | Fugu |
BCL2L1 (6 of 6) | paralogy | Fugu |
T_rubripes_ENSTRUP00000006891 | paralogy | Fugu |
BCL2L1 (5 of 6) | paralogy | Fugu |
BCL2L1 (1 of 6) | paralogy | Fugu |
BCL2L1 (2 of 6) | paralogy | Fugu |
BCL2L1 (3 of 6) | paralogy | Fugu |
BAX | paralogy | Fugu |
BCL2L1 (4 of 6) | paralogy | Fugu |
BCL2L1 (1 of 2) | paralogy | Gasterosteus |
BOK (1 of 2) | paralogy | Gasterosteus |
BCL2L1 (2 of 2) | paralogy | Gasterosteus |
MCL1 | paralogy | Gasterosteus |
BAX | paralogy | Gasterosteus |
G_aculeatus_ENSGACP00000018978 | paralogy | Gasterosteus |
BCL2L2 | paralogy | Gorilla |
MCL1 | paralogy | Gorilla |
BAK1 | paralogy | Gorilla |
BCL2A1 | paralogy | Horse |
BCL2L2 | paralogy | Horse |
BCL2L1 | paralogy | Horse |
MCL1 | paralogy | Horse |
BAK1 | paralogy | Horse |
BCL2L2 | paralogy | Human |
BCL2A1 | paralogy | Human |
BAX | paralogy | Human |
MCL1 | paralogy | Human |
BAK1 | paralogy | Human |
BCL2L1 | paralogy | Human |
BOK | paralogy | Lyzard |
A_carolinensis_ENSACAP00000004550 | paralogy | Lyzard |
MCL1 | paralogy | Lyzard |
BCL2L1 | paralogy | Lyzard |
BCL2A1 | paralogy | Lyzard |
BAK1 | paralogy | Lyzard |
BAX | paralogy | Lyzard |
BCL2A1 | paralogy | Macaca |
BAX | paralogy | Macaca |
BCL2L1 | paralogy | Macaca |
MCL1 | paralogy | Macaca |
BAK1 | paralogy | Macaca |
BCL2L2 | paralogy | Macaca |
BAX | paralogy | Medaka |
BCL2L1 | paralogy | Medaka |
M_domestica_ENSMODP00000005598 | paralogy | Monodelphis |
BAX | paralogy | Monodelphis |
BAK1 | paralogy | Monodelphis |
MCL1 | paralogy | Monodelphis |
BCL2A1 | paralogy | Monodelphis |
BCL2L1 | paralogy | Monodelphis |
M_domestica_ENSMODP00000037249 | paralogy | Monodelphis |
Bcl2a1a | paralogy | Mouse |
Bcl2a1a | paralogy | Mouse |
Bcl2l2 | paralogy | Mouse |
Bax | paralogy | Mouse |
Mcl1 | paralogy | Mouse |
Bcl2a1d | paralogy | Mouse |
Bak1 | paralogy | Mouse |
Bcl2l1 | paralogy | Mouse |
MCL1 | paralogy | Orangutan |
P_pygmaeus_ENSPPYP00000006150 | paralogy | Orangutan |
BCL2A1 | paralogy | Orangutan |
BCL2L1 | paralogy | Orangutan |
BCL2L2 | paralogy | Ornithorhynchus |
BAK1 | paralogy | Rabbit |
Q9MYW4_RABIT | paralogy | Rabbit |
BCL2A1 | paralogy | Rabbit |
MCL1 | paralogy | Rabbit |
Bak1 | paralogy | Rat |
LOC684140 | paralogy | Rat |
Bax | paralogy | Rat |
Bcl2a1 | paralogy | Rat |
BCLX_RAT | paralogy | Rat |
R_norvegicus_ENSRNOP00000052069 | paralogy | Rat |
RGD1565822_predicted | paralogy | Rat |
BOK (1 of 2) | paralogy | Tetraodon |
BCL2L1 (1 of 3) | paralogy | Tetraodon |
BCL2L1 (2 of 3) | paralogy | Tetraodon |
BCL2L1 (3 of 3) | paralogy | Tetraodon |
T_nigroviridis_ENSTNIP00000017211 | paralogy | Tetraodon |
MCL1 | paralogy | Xenopus |
bcl2l2 | paralogy | Xenopus |
bax | paralogy | Xenopus |
BCL2L1 | paralogy | Xenopus |
BAK1 | paralogy | Xenopus |
BCL2L1 | paralogy | Zebra finch |
BCL2A1 | paralogy | Zebra finch |
BOK | paralogy | Zebra finch |
mcl1b | paralogy | Zebrafish |
mcl1a | paralogy | Zebrafish |
baxa | paralogy | Zebrafish |
D_rerio_ENSDARP00000037180 | paralogy | Zebrafish |
BAXB | paralogy | Zebrafish |
boka | paralogy | Zebrafish |
bcl2l | paralogy | Zebrafish |
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0000082 | G1/S transition of mitotic cell cycle | biological_proccess | IEA |
GO:0000902 | cell morphogenesis | biological_proccess | IEA |
GO:0001101 | response to acid | biological_proccess | IEA |
GO:0001541 | ovarian follicle development | biological_proccess | IEA |
GO:0001657 | ureteric bud development | biological_proccess | IEA |
GO:0001658 | ureteric bud branching | biological_proccess | IEA |
GO:0001662 | behavioral fear response | biological_proccess | IEA |
GO:0001666 | response to hypoxia | biological_proccess | IEA |
GO:0001782 | B cell homeostasis | biological_proccess | IEA |
GO:0001952 | regulation of cell-matrix adhesion | biological_proccess | IEA |
GO:0002320 | lymphoid progenitor cell differentiation | biological_proccess | IEA |
GO:0002326 | B cell lineage commitment | biological_proccess | IEA |
GO:0002360 | T cell lineage commitment | biological_proccess | IEA |
GO:0002520 | immune system development | biological_proccess | IEA |
GO:0003014 | renal system process | biological_proccess | IEA |
GO:0006470 | protein amino acid dephosphorylation | biological_proccess | IEA |
GO:0006800 | oxygen and reactive oxygen species metabolic process | biological_proccess | IEA |
GO:0006808 | regulation of nitrogen utilization | biological_proccess | IEA |
GO:0007015 | actin filament organization | biological_proccess | IEA |
GO:0007569 | cell aging | biological_proccess | IEA |
GO:0007584 | response to nutrient | biological_proccess | IEA |
GO:0008284 | positive regulation of cell proliferation | biological_proccess | IEA |
GO:0008584 | male gonad development | biological_proccess | IEA |
GO:0009605 | response to external stimulus | biological_proccess | IEA |
GO:0009791 | post-embryonic development | biological_proccess | IEA |
GO:0010035 | response to inorganic substance | biological_proccess | IEA |
GO:0010224 | response to UV-B | biological_proccess | IEA |
GO:0010332 | response to gamma radiation | biological_proccess | IEA |
GO:0010523 | negative regulation of calcium ion transport into cytosol | biological_proccess | IEA |
GO:0010559 | regulation of glycoprotein biosynthetic process | biological_proccess | IEA |
GO:0014031 | mesenchymal cell development | biological_proccess | IEA |
GO:0014042 | positive regulation of neuron maturation | biological_proccess | IEA |
GO:0016337 | cell-cell adhesion | biological_proccess | IEA |
GO:0018107 | peptidyl-threonine phosphorylation | biological_proccess | IEA |
GO:0022612 | gland morphogenesis | biological_proccess | IEA |
GO:0030097 | hemopoiesis | biological_proccess | IEA |
GO:0030279 | negative regulation of ossification | biological_proccess | IEA |
GO:0030336 | negative regulation of cell migration | biological_proccess | IEA |
GO:0031000 | response to caffeine | biological_proccess | IEA |
GO:0031069 | hair follicle morphogenesis | biological_proccess | IEA |
GO:0031647 | regulation of protein stability | biological_proccess | IEA |
GO:0032469 | endoplasmic reticulum calcium ion homeostasis | biological_proccess | IEA |
GO:0032880 | regulation of protein localization | biological_proccess | IEA |
GO:0033033 | negative regulation of myeloid cell apoptosis | biological_proccess | IEA |
GO:0033077 | T cell differentiation in the thymus | biological_proccess | IEA |
GO:0033689 | negative regulation of osteoblast proliferation | biological_proccess | IEA |
GO:0035265 | organ growth | biological_proccess | IEA |
GO:0042542 | response to hydrogen peroxide | biological_proccess | IEA |
GO:0043029 | T cell homeostasis | biological_proccess | IEA |
GO:0043085 | positive regulation of catalytic activity | biological_proccess | IEA |
GO:0043375 | CD8-positive, alpha-beta T cell lineage commitment | biological_proccess | IEA |
GO:0043434 | response to peptide hormone stimulus | biological_proccess | IEA |
GO:0043627 | response to estrogen stimulus | biological_proccess | IEA |
GO:0045069 | regulation of viral genome replication | biological_proccess | IEA |
GO:0045471 | response to ethanol | biological_proccess | IEA |
GO:0045930 | negative regulation of mitotic cell cycle | biological_proccess | IEA |
GO:0046671 | negative regulation of retinal cell programmed cell death | biological_proccess | IEA |
GO:0048041 | focal adhesion formation | biological_proccess | IEA |
GO:0048087 | positive regulation of pigmentation during development | biological_proccess | IEA |
GO:0048536 | spleen development | biological_proccess | IEA |
GO:0048547 | gut morphogenesis | biological_proccess | IEA |
GO:0048589 | developmental growth | biological_proccess | IEA |
GO:0048599 | oocyte development | biological_proccess | IEA |
GO:0048753 | pigment granule organization | biological_proccess | IEA |
GO:0048873 | homeostasis of number of cells within a tissue | biological_proccess | IEA |
GO:0051384 | response to glucocorticoid stimulus | biological_proccess | IEA |
GO:0051726 | regulation of cell cycle | biological_proccess | IEA |
GO:0009636 | response to toxin | biological_proccess | IDA |
GO:0051881 | regulation of mitochondrial membrane potential | biological_proccess | ISS |
GO:0031103 | axon regeneration | biological_proccess | IEA |
GO:0032835 | glomerulus development | biological_proccess | IEA |
GO:0033138 | positive regulation of peptidyl-serine phosphorylation | biological_proccess | IEA |
GO:0040018 | positive regulation of multicellular organism growth | biological_proccess | IEA |
GO:0043583 | ear development | biological_proccess | IEA |
GO:0045636 | positive regulation of melanocyte differentiation | biological_proccess | IEA |
GO:0048538 | thymus development | biological_proccess | IEA |
GO:0048743 | positive regulation of skeletal muscle fiber development | biological_proccess | IEA |
GO:0051789 | response to protein stimulus | biological_proccess | IEA |
GO:0006582 | melanin metabolic process | biological_proccess | IEA |
GO:0006979 | response to oxidative stress | biological_proccess | IEA |
GO:0009408 | response to heat | biological_proccess | IEA |
GO:0009887 | organ morphogenesis | biological_proccess | IEA |
GO:0010468 | regulation of gene expression | biological_proccess | IEA |
GO:0014911 | positive regulation of smooth muscle cell migration | biological_proccess | IEA |
GO:0021747 | cochlear nucleus development | biological_proccess | IEA |
GO:0030308 | negative regulation of cell growth | biological_proccess | IEA |
GO:0008219 | cell death | biological_proccess | IDA |
GO:0034097 | response to cytokine stimulus | biological_proccess | IDA |
GO:0042100 | B cell proliferation | biological_proccess | IDA |
GO:0042493 | response to drug | biological_proccess | IDA |
GO:0043524 | negative regulation of neuron apoptosis | biological_proccess | IDA |
GO:0051924 | regulation of calcium ion transport | biological_proccess | IDA |
GO:0070059 | apoptosis in response to endoplasmic reticulum stress | biological_proccess | IDA |
GO:0008633 | activation of pro-apoptotic gene products | biological_proccess | EXP |
GO:0006916 | anti-apoptosis | biological_proccess | IDA |
GO:0051607 | defense response to virus | biological_proccess | IDA |
GO:0007565 | female pregnancy | biological_proccess | NAS |
GO:0010039 | response to iron ion | biological_proccess | IDA |
GO:0043496 | regulation of protein homodimerization activity | biological_proccess | IDA |
GO:0043497 | regulation of protein heterodimerization activity | biological_proccess | IDA |
GO:0035094 | response to nicotine | biological_proccess | IDA |
GO:0009314 | response to radiation | biological_proccess | NAS |
GO:0006959 | humoral immune response | biological_proccess | TAS |
GO:0032848 | negative regulation of cellular pH reduction | biological_proccess | IDA |
GO:0051902 | negative regulation of mitochondrial depolarization | biological_proccess | TAS |
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | NAS |
GO:0046902 | regulation of mitochondrial membrane permeability | biological_proccess | ISS |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0008285 | negative regulation of cell proliferation | biological_proccess | IEA |
GO:0007409 | axonogenesis | biological_proccess | IEA |
GO:0008283 | cell proliferation | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | IEA |
GO:0008219 | cell death | biological_proccess | IEA |
GO:0030183 | B cell differentiation | biological_proccess | IEA |
GO:0009636 | response to toxin | biological_proccess | IEA |
GO:0048066 | pigmentation during development | biological_proccess | IEA |
GO:0042493 | response to drug | biological_proccess | IEA |
GO:0006874 | cellular calcium ion homeostasis | biological_proccess | IEA |
GO:0001822 | kidney development | biological_proccess | IEA |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IEA |
GO:0016049 | cell growth | biological_proccess | IEA |
GO:0034097 | response to cytokine stimulus | biological_proccess | IEA |
GO:0001503 | ossification | biological_proccess | IEA |
GO:0030318 | melanocyte differentiation | biological_proccess | IEA |
GO:0051881 | regulation of mitochondrial membrane potential | biological_proccess | IEA |
GO:0051402 | neuron apoptosis | biological_proccess | IEA |
GO:0050790 | regulation of catalytic activity | biological_proccess | IEA |
GO:0042221 | response to chemical stimulus | biological_proccess | IEA |
GO:0048545 | response to steroid hormone stimulus | biological_proccess | IEA |
GO:0043524 | negative regulation of neuron apoptosis | biological_proccess | IEA |
GO:0018105 | peptidyl-serine phosphorylation | biological_proccess | IEA |
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IEA |
GO:0048070 | regulation of pigmentation during development | biological_proccess | IEA |
GO:0001656 | metanephros development | biological_proccess | IEA |
GO:0030217 | T cell differentiation | biological_proccess | IEA |
GO:0040007 | growth | biological_proccess | IEA |
GO:0046902 | regulation of mitochondrial membrane permeability | biological_proccess | IEA |
GO:0001776 | leukocyte homeostasis | biological_proccess | IEA |
GO:0043067 | regulation of programmed cell death | biological_proccess | IEA |
GO:0002260 | lymphocyte homeostasis | biological_proccess | IEA |
GO:0046688 | response to copper ion | biological_proccess | IEA |
GO:0051412 | response to corticosterone stimulus | biological_proccess | IEA |
GO:0010044 | response to aluminum ion | biological_proccess | IEA |
GO:0035094 | response to nicotine | biological_proccess | IEA |
GO:0051593 | response to folic acid | biological_proccess | IEA |
GO:0008134 | transcription factor binding | mollecular_function | IEA |
GO:0002020 | protease binding | mollecular_function | IDA |
GO:0042803 | protein homodimerization activity | mollecular_function | IDA |
GO:0046982 | protein heterodimerization activity | mollecular_function | IPI |
GO:0051434 | BH3 domain binding | mollecular_function | IPI |
GO:0016563 | transcription activator activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0046982 | protein heterodimerization activity | mollecular_function | IEA |
GO:0000159 | protein phosphatase type 2A complex | cell_component | IEA |
GO:0005622 | intracellular | cell_component | IEA |
GO:0005624 | membrane fraction | cell_component | IEA |
GO:0005792 | microsome | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0005955 | calcineurin complex | cell_component | IEA |
GO:0043209 | myelin sheath | cell_component | IEA |
GO:0005789 | endoplasmic reticulum membrane | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IDA |
GO:0016020 | membrane | cell_component | IDA |
GO:0005741 | mitochondrial outer membrane | cell_component | EXP |
GO:0005783 | endoplasmic reticulum | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IDA |
GO:0005739 | mitochondrion | cell_component | IDA |
GO:0031965 | nuclear membrane | cell_component | IDA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0031965 | nuclear membrane | cell_component | IEA |
GO:0031966 | mitochondrial membrane | cell_component | IEA |
Check GO Evidence Codes here
miRNAs [+]
miRNA | Regulation | Description | Pubmed |
---|---|---|---|
hsa-miR-15a | overexpression by mature miRNA transfection | Then we investigated whether both miRNAs affect Bcl2 protein expression or this effect is restricted to only one of them.We have transiently transfected miR-15a and miR-16-1 sense and antisense oligo RNAs into the same MEG-01 cell line. As shown in Fig. 2B, separate transfections of miR-15a-sense and miR-16-1-sense, respectively, completely abolished BCL2 expression,whereas transfection of antisense RNAs did not. Similar data were obtained by cotransfection with both sense RNAs or both antisense RNAs, confirming that both miR-15a and miR-16-1 influence Bcl2 protein expression. | Ref. |
hsa-miR-15a | overexpression by mature miRNA transfection | We haveevaluated mRNA levels by amplifying BCL2 cDNA from cells transfected with the pSR-miR-15_16-WT or with specific miR-15a and miR-16-1 RNA oligos by RT-PCR. No differences in the levels of BCL2 expression were observed between any of these samples and control cells (untransfected or transfected with the empty vector) (Fig. 2B). This result demonstrates that miR-15a and miR-16-1 do not affect mRNA stability and regulate Bcl2 expression at the posttranscriptional level. | Ref. |
hsa-miR-15a/hsa-miR-16 | overexpression | By proteomics analysis, we identified proteins whose intensity was reduced 4-fold or more in the pRS15/16 group with respect to the pRS-E group. We isolated 27 different proteins (Table 3 and SI Table 9). Interestingly, BCL2, which we had already shown as a target of miR-15a/16-1 (22), and WT1, another predicted target of these miRNAs, were identified. The targeted proteins have a variety of biological functions and can be grouped into four groups. The first group includes proteins that play a role in regulation of cell growth and cell cycle (Ruvbl1, Anxa2, Rcn1, Cct7, Sugt1, Cdc2, Psf1), another category is formed by antiapoptotic proteins (Grp78, Bcl2,Pdia2), and proteins involved in human tumorigenesis, either as oncogenes, or as tumor-suppressor genes (Wt1, MageB3, Rab9B). | Ref. |
hsa-miR-15a/hsa-miR-16 | overexpression | To validate the results obtained by transcriptomic or proteomic analyses, we assayed the expression of nine genes (four identified by the EST microarray, two by proteomics, and three identified by neither of the techniques and therefore considered as negative controls), by qRT-PCR in MEG-01 cells transfected with pRS15/16 or pRS-E (control). As shown in Fig. 2A, the transfection with miR-15a/16-1 reduces the expression of both microarray identified mRNAs (PDCD4, RAB21, IGSF4, SCAP2) and proteomics identified proteins (Bcl2, Wt1). | Ref. |
hsa-miR-16 | overexpression by mature miRNA transfection | Then we investigated whether both miRNAs affect Bcl2 protein expression or this effect is restricted to only one of them.We have transiently transfected miR-15a and miR-16-1 sense and antisense oligo RNAs into the same MEG-01 cell line. As shown in Fig. 2B, separate transfections of miR-15a-sense and miR-16-1-sense, respectively, completely abolished BCL2 expression,whereas transfection of antisense RNAs did not. Similar data were obtained by cotransfection with both sense RNAs or both antisense RNAs, confirming that both miR-15a and miR-16-1 influence Bcl2 protein expression. | Ref. |
hsa-miR-16 | overexpression by mature miRNA transfection | We haveevaluated mRNA levels by amplifying BCL2 cDNA from cells transfected with the pSR-miR-15_16-WT or with specific miR-15a and miR-16-1 RNA oligos by RT-PCR. No differences in the levels of BCL2 expression were observed between any of these samples and control cells (untransfected or transfected with the empty vector) (Fig. 2B). This result demonstrates that miR-15a and miR-16-1 do not affect mRNA stability and regulate Bcl2 expression at the posttranscriptional level. | Ref. |
hsa-miR-34a | downregulation by LNA antisense miRNA oligonucleot | To inhibit all three miRNA34 members, we cotransfected Wi38 cells with antisense locked nucleic acid (LNA) oligonucleotides (miRNA34as) targeting all three isoforms. Inhibition of miRNA34 in Wi38 cells led to an increase in BCL2 levels within 36 hr (Figure 4C). | Ref. |
Curated Isoforms [+]
Transcript | Translation |
---|---|
OTTHUMT00000256199 * | OTTHUMP00000163680 * |
Info from The Vertebrate Genome Annotation (VEGA) database.
(*) Canonical transcript and translation forms.
Information from other databases [+]
- Gene info from HGNC [?] :990
- Gene related info from GeneCards [?] : BCL2
- Ensembl genome browser [?] : ENSG00000171791
- Expression info from Arrayexpress [?] : ENSG00000171791
- Protein expression from Protein Atlas: [?] ENSG00000171791
- Community gene edition from Wikigenes: [?] 596
Click on [?] for more information.