BCLW_BOVIN (Bos taurus)
Description [+]
- Synonyms: BCLW_BOVIN
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Ruminantia; Bos taurus
- Short gene description: Apoptosis regulator Bcl-W (Bcl-2-like 2 protein) [Source:UniProtKB/Swiss-Prot;Acc:Q1RMX3]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: BCLW_BOVIN-B_taurus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | BH4 | 6 | 32 |
PFAM A | Bcl-2 | 46 | 144 |
Protein sequence [+]
BCLW_BOVIN | Bos taurus | 9913 | length:193
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRT
FSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVG
QVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVAL
GALVTVGAFFASK
FSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVG
QVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVAL
GALVTVGAFFASK
Structure links:
- Smartdomain prediction information: SM00265
- Smartdomain prediction information: SM00337
- Prosite motif and domain information: PS01080
- Prosite motif and domain information: PS01258
- Prosite motif and domain information: PS01260
- Interpro domain information: Q1RMX3
- PFAM domain and domain family information: Q1RMX3
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0060011 | Sertoli cell proliferation | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0031966 | mitochondrial membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSBTAG00000019692
- Expression info from Arrayexpress [?] : ENSBTAG00000019692
- Protein expression from Protein Atlas: [?] ENSBTAG00000019692
- entrezgene: 767601
- refseq_dna: NM_001076533
- refseq_peptide: NP_001070001
Click on [?] for more information.