NP_001026091.1 (Gallus gallus)
Description [+]
- Synonyms: NP_001026091.1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Aves; Gallus gallus
- Short gene description: BCL2-antagonist/killer 1 [Source:RefSeq_peptide;Acc:NP_001026091]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NP_001026091.1-G_gallus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Bcl-2 | 83 | 182 |
Protein sequence [+]
NP_001026091.1 | Gallus gallus | 9031 | length:216
MEGNEGDPPGAHRRRDSHGRRPSREINAEDQVAQETEEVFRSYTFYRYQQEREEGGAEVP
MDPEIMEIQQELGSTGSQVGRRLAIIGDDINKRYDAEFRHMLKSLQPTKENAYEYFTTIA
SSLFDSGINWGRVIALLGFGYCMAIHVYQQGITGFLRRIARYVTEFMLRNRIARWIAQQG
GWVAALDLDNVYMKYMLVVLALVMVGHLVVRRFFRP
MDPEIMEIQQELGSTGSQVGRRLAIIGDDINKRYDAEFRHMLKSLQPTKENAYEYFTTIA
SSLFDSGINWGRVIALLGFGYCMAIHVYQQGITGFLRRIARYVTEFMLRNRIARWIAQQG
GWVAALDLDNVYMKYMLVVLALVMVGHLVVRRFFRP
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0001776 | leukocyte homeostasis | biological_proccess | IEA |
GO:0001782 | B cell homeostasis | biological_proccess | IEA |
GO:0001783 | B cell apoptosis | biological_proccess | IEA |
GO:0001974 | blood vessel remodeling | biological_proccess | IEA |
GO:0002262 | myeloid cell homeostasis | biological_proccess | IEA |
GO:0002352 | B cell negative selection | biological_proccess | IEA |
GO:0006919 | activation of caspase activity | biological_proccess | IEA |
GO:0008053 | mitochondrial fusion | biological_proccess | IEA |
GO:0008283 | cell proliferation | biological_proccess | IEA |
GO:0008635 | activation of caspase activity by cytochrome c | biological_proccess | IEA |
GO:0009620 | response to fungus | biological_proccess | IEA |
GO:0010046 | response to mycotoxin | biological_proccess | IEA |
GO:0010332 | response to gamma radiation | biological_proccess | IEA |
GO:0010524 | positive regulation of calcium ion transport into cytosol | biological_proccess | IEA |
GO:0032471 | reduction of endoplasmic reticulum calcium ion concentration | biological_proccess | IEA |
GO:0033137 | negative regulation of peptidyl-serine phosphorylation | biological_proccess | IEA |
GO:0035108 | limb morphogenesis | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0048597 | post-embryonic camera-type eye morphogenesis | biological_proccess | IEA |
GO:0048872 | homeostasis of number of cells | biological_proccess | IEA |
GO:0051726 | regulation of cell cycle | biological_proccess | IEA |
GO:0060068 | vagina development | biological_proccess | IEA |
GO:0070059 | apoptosis in response to endoplasmic reticulum stress | biological_proccess | IEA |
GO:0005622 | intracellular | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005783 | endoplasmic reticulum | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0031966 | mitochondrial membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSGALG00000003182
- Expression info from Arrayexpress [?] : ENSGALG00000003182
- Protein expression from Protein Atlas: [?] ENSGALG00000003182
- entrezgene: 419912
- refseq_dna: NM_001030920
- refseq_peptide: NP_001026091
Click on [?] for more information.