BCL2 (Macaca mulatta)
Description [+]
- Synonyms: BCL2
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Cercopithecidae; Macaca mulatta
- Short gene description: Apoptosis regulator Bcl-2 [Source:UniProtKB/Swiss-Prot;Acc:P10415]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: BCL2-M_mulatta
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | BH4 | 7 | 33 |
PFAM A | Bcl-2 | 99 | 197 |
Protein sequence [+]
BCL2 | Macaca mulatta | 9544 | length:241
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLPTPAAPAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQ
LHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMT
EYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGH
K
ASRDPVARTSPLPTPAAPAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQ
LHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMT
EYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGH
K
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0006412 | translation | biological_proccess | IEA |
GO:0042493 | response to drug | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | IEA |
GO:0043524 | negative regulation of neuron apoptosis | biological_proccess | IEA |
GO:0010039 | response to iron ion | biological_proccess | IEA |
GO:0043497 | regulation of protein heterodimerization activity | biological_proccess | IEA |
GO:0034097 | response to cytokine stimulus | biological_proccess | IEA |
GO:0008219 | cell death | biological_proccess | IEA |
GO:0009636 | response to toxin | biological_proccess | IEA |
GO:0070059 | apoptosis in response to endoplasmic reticulum stress | biological_proccess | IEA |
GO:0035094 | response to nicotine | biological_proccess | IEA |
GO:0051607 | defense response to virus | biological_proccess | IEA |
GO:0043496 | regulation of protein homodimerization activity | biological_proccess | IEA |
GO:0051924 | regulation of calcium ion transport | biological_proccess | IEA |
GO:0042100 | B cell proliferation | biological_proccess | IEA |
GO:0032848 | negative regulation of cellular pH reduction | biological_proccess | IEA |
GO:0001782 | B cell homeostasis | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0000082 | G1/S transition of mitotic cell cycle | biological_proccess | IEA |
GO:0010468 | regulation of gene expression | biological_proccess | IEA |
GO:0031103 | axon regeneration | biological_proccess | IEA |
GO:0008285 | negative regulation of cell proliferation | biological_proccess | IEA |
GO:0006800 | oxygen and reactive oxygen species metabolic process | biological_proccess | IEA |
GO:0007409 | axonogenesis | biological_proccess | IEA |
GO:0006808 | regulation of nitrogen utilization | biological_proccess | IEA |
GO:0009791 | post-embryonic development | biological_proccess | IEA |
GO:0006470 | protein amino acid dephosphorylation | biological_proccess | IEA |
GO:0048873 | homeostasis of number of cells within a tissue | biological_proccess | IEA |
GO:0001541 | ovarian follicle development | biological_proccess | IEA |
GO:0008283 | cell proliferation | biological_proccess | IEA |
GO:0051726 | regulation of cell cycle | biological_proccess | IEA |
GO:0040018 | positive regulation of multicellular organism growth | biological_proccess | IEA |
GO:0008284 | positive regulation of cell proliferation | biological_proccess | IEA |
GO:0048589 | developmental growth | biological_proccess | IEA |
GO:0030183 | B cell differentiation | biological_proccess | IEA |
GO:0000902 | cell morphogenesis | biological_proccess | IEA |
GO:0009887 | organ morphogenesis | biological_proccess | IEA |
GO:0006979 | response to oxidative stress | biological_proccess | IEA |
GO:0051384 | response to glucocorticoid stimulus | biological_proccess | IEA |
GO:0048066 | pigmentation during development | biological_proccess | IEA |
GO:0006874 | cellular calcium ion homeostasis | biological_proccess | IEA |
GO:0048536 | spleen development | biological_proccess | IEA |
GO:0048538 | thymus development | biological_proccess | IEA |
GO:0001822 | kidney development | biological_proccess | IEA |
GO:0030097 | hemopoiesis | biological_proccess | IEA |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IEA |
GO:0007015 | actin filament organization | biological_proccess | IEA |
GO:0031069 | hair follicle morphogenesis | biological_proccess | IEA |
GO:0035265 | organ growth | biological_proccess | IEA |
GO:0030336 | negative regulation of cell migration | biological_proccess | IEA |
GO:0030308 | negative regulation of cell growth | biological_proccess | IEA |
GO:0016049 | cell growth | biological_proccess | IEA |
GO:0048041 | focal adhesion formation | biological_proccess | IEA |
GO:0016337 | cell-cell adhesion | biological_proccess | IEA |
GO:0001503 | ossification | biological_proccess | IEA |
GO:0030318 | melanocyte differentiation | biological_proccess | IEA |
GO:0001658 | ureteric bud branching | biological_proccess | IEA |
GO:0051881 | regulation of mitochondrial membrane potential | biological_proccess | IEA |
GO:0051402 | neuron apoptosis | biological_proccess | IEA |
GO:0007569 | cell aging | biological_proccess | IEA |
GO:0050790 | regulation of catalytic activity | biological_proccess | IEA |
GO:0018107 | peptidyl-threonine phosphorylation | biological_proccess | IEA |
GO:0042221 | response to chemical stimulus | biological_proccess | IEA |
GO:0048545 | response to steroid hormone stimulus | biological_proccess | IEA |
GO:0008584 | male gonad development | biological_proccess | IEA |
GO:0001662 | behavioral fear response | biological_proccess | IEA |
GO:0043029 | T cell homeostasis | biological_proccess | IEA |
GO:0051789 | response to protein stimulus | biological_proccess | IEA |
GO:0009605 | response to external stimulus | biological_proccess | IEA |
GO:0042542 | response to hydrogen peroxide | biological_proccess | IEA |
GO:0010332 | response to gamma radiation | biological_proccess | IEA |
GO:0033077 | T cell differentiation in the thymus | biological_proccess | IEA |
GO:0001101 | response to acid | biological_proccess | IEA |
GO:0030279 | negative regulation of ossification | biological_proccess | IEA |
GO:0043583 | ear development | biological_proccess | IEA |
GO:0018105 | peptidyl-serine phosphorylation | biological_proccess | IEA |
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IEA |
GO:0032880 | regulation of protein localization | biological_proccess | IEA |
GO:0043085 | positive regulation of catalytic activity | biological_proccess | IEA |
GO:0048070 | regulation of pigmentation during development | biological_proccess | IEA |
GO:0001656 | metanephros development | biological_proccess | IEA |
GO:0032835 | glomerulus development | biological_proccess | IEA |
GO:0001657 | ureteric bud development | biological_proccess | IEA |
GO:0002320 | lymphoid progenitor cell differentiation | biological_proccess | IEA |
GO:0030217 | T cell differentiation | biological_proccess | IEA |
GO:0031647 | regulation of protein stability | biological_proccess | IEA |
GO:0040007 | growth | biological_proccess | IEA |
GO:0003014 | renal system process | biological_proccess | IEA |
GO:0045930 | negative regulation of mitotic cell cycle | biological_proccess | IEA |
GO:0002360 | T cell lineage commitment | biological_proccess | IEA |
GO:0001952 | regulation of cell-matrix adhesion | biological_proccess | IEA |
GO:0002326 | B cell lineage commitment | biological_proccess | IEA |
GO:0002520 | immune system development | biological_proccess | IEA |
GO:0006582 | melanin metabolic process | biological_proccess | IEA |
GO:0010224 | response to UV-B | biological_proccess | IEA |
GO:0010523 | negative regulation of calcium ion transport into cytosol | biological_proccess | IEA |
GO:0010559 | regulation of glycoprotein biosynthetic process | biological_proccess | IEA |
GO:0014031 | mesenchymal cell development | biological_proccess | IEA |
GO:0014042 | positive regulation of neuron maturation | biological_proccess | IEA |
GO:0014911 | positive regulation of smooth muscle cell migration | biological_proccess | IEA |
GO:0021747 | cochlear nucleus development | biological_proccess | IEA |
GO:0022612 | gland morphogenesis | biological_proccess | IEA |
GO:0032469 | endoplasmic reticulum calcium ion homeostasis | biological_proccess | IEA |
GO:0033033 | negative regulation of myeloid cell apoptosis | biological_proccess | IEA |
GO:0033138 | positive regulation of peptidyl-serine phosphorylation | biological_proccess | IEA |
GO:0033689 | negative regulation of osteoblast proliferation | biological_proccess | IEA |
GO:0043375 | CD8-positive, alpha-beta T cell lineage commitment | biological_proccess | IEA |
GO:0045069 | regulation of viral genome replication | biological_proccess | IEA |
GO:0045636 | positive regulation of melanocyte differentiation | biological_proccess | IEA |
GO:0046671 | negative regulation of retinal cell programmed cell death | biological_proccess | IEA |
GO:0046902 | regulation of mitochondrial membrane permeability | biological_proccess | IEA |
GO:0048087 | positive regulation of pigmentation during development | biological_proccess | IEA |
GO:0048547 | gut morphogenesis | biological_proccess | IEA |
GO:0048599 | oocyte development | biological_proccess | IEA |
GO:0048743 | positive regulation of skeletal muscle fiber development | biological_proccess | IEA |
GO:0048753 | pigment granule organization | biological_proccess | IEA |
GO:0001776 | leukocyte homeostasis | biological_proccess | IEA |
GO:0043067 | regulation of programmed cell death | biological_proccess | IEA |
GO:0002260 | lymphocyte homeostasis | biological_proccess | IEA |
GO:0003735 | structural constituent of ribosome | mollecular_function | IEA |
GO:0042803 | protein homodimerization activity | mollecular_function | IEA |
GO:0046982 | protein heterodimerization activity | mollecular_function | IEA |
GO:0002020 | protease binding | mollecular_function | IEA |
GO:0051434 | BH3 domain binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0008134 | transcription factor binding | mollecular_function | IEA |
GO:0016563 | transcription activator activity | mollecular_function | IEA |
GO:0005622 | intracellular | cell_component | IEA |
GO:0005840 | ribosome | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0031965 | nuclear membrane | cell_component | IEA |
GO:0005783 | endoplasmic reticulum | cell_component | IEA |
GO:0005789 | endoplasmic reticulum membrane | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0005624 | membrane fraction | cell_component | IEA |
GO:0005792 | microsome | cell_component | IEA |
GO:0031966 | mitochondrial membrane | cell_component | IEA |
GO:0043209 | myelin sheath | cell_component | IEA |
GO:0000159 | protein phosphatase type 2A complex | cell_component | IEA |
GO:0005955 | calcineurin complex | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSMMUG00000006577
- Expression info from Arrayexpress [?] : ENSMMUG00000006577
- Protein expression from Protein Atlas: [?] ENSMMUG00000006577
Click on [?] for more information.