BAK1 (Anolis carolinensis)
Description [+]
- Synonyms: BAK1
- Species: Anolis carolinensis
- Short gene description: Bcl-2 homologous antagonist/killer (Apoptosis regulator BAK)(Bcl-2-like 7 protein) [Source:UniProtKB/Swiss-Prot;Acc:Q16611]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: BAK1-A_carolinensis
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Bcl-2 | 56 | 155 |
Protein sequence [+]
BAK1 | Anolis carolinensis | 28377 | length:189
AEDQVAQETEEVFQSYAFYRYQQEREQTEGDVPHDPEIAAIPHEPNSTNCQVGRRLATIG
DDINARYDKEFSEMLKSLQPTKDNAYEYFIRIASSLFESGINWGRVIALLGFGYRMAIHV
YQHGMTGFLRRIARYMADFVLRNRIARWIAQQGGWVAALDLSNVYLKYVLIVAAVILLGQ
FVVRRFFNP
DDINARYDKEFSEMLKSLQPTKDNAYEYFIRIASSLFESGINWGRVIALLGFGYRMAIHV
YQHGMTGFLRRIARYMADFVLRNRIARWIAQQGGWVAALDLSNVYLKYVLIVAAVILLGQ
FVVRRFFNP
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0001782 | B cell homeostasis | biological_proccess | IEA |
GO:0008283 | cell proliferation | biological_proccess | IEA |
GO:0051726 | regulation of cell cycle | biological_proccess | IEA |
GO:0006919 | activation of caspase activity | biological_proccess | IEA |
GO:0048872 | homeostasis of number of cells | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0010332 | response to gamma radiation | biological_proccess | IEA |
GO:0001974 | blood vessel remodeling | biological_proccess | IEA |
GO:0002262 | myeloid cell homeostasis | biological_proccess | IEA |
GO:0001783 | B cell apoptosis | biological_proccess | IEA |
GO:0009620 | response to fungus | biological_proccess | IEA |
GO:0008053 | mitochondrial fusion | biological_proccess | IEA |
GO:0035108 | limb morphogenesis | biological_proccess | IEA |
GO:0048597 | post-embryonic camera-type eye morphogenesis | biological_proccess | IEA |
GO:0001776 | leukocyte homeostasis | biological_proccess | IEA |
GO:0033137 | negative regulation of peptidyl-serine phosphorylation | biological_proccess | IEA |
GO:0070059 | apoptosis in response to endoplasmic reticulum stress | biological_proccess | IEA |
GO:0002352 | B cell negative selection | biological_proccess | IEA |
GO:0008635 | activation of caspase activity by cytochrome c | biological_proccess | IEA |
GO:0010046 | response to mycotoxin | biological_proccess | IEA |
GO:0010524 | positive regulation of calcium ion transport into cytosol | biological_proccess | IEA |
GO:0032471 | reduction of endoplasmic reticulum calcium ion concentration | biological_proccess | IEA |
GO:0060068 | vagina development | biological_proccess | IEA |
GO:0005622 | intracellular | cell_component | IEA |
GO:0005783 | endoplasmic reticulum | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0031966 | mitochondrial membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSACAG00000016485
- Expression info from Arrayexpress [?] : ENSACAG00000016485
- Protein expression from Protein Atlas: [?] ENSACAG00000016485
Click on [?] for more information.