BCL2L1 (Pongo pygmaeus)
Description [+]
- Synonyms: BCL2L1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Pongo pygmaeus
- Short gene description: Apoptosis regulator Bcl-X (Bcl-2-like 1 protein) [Source:UniProtKB/Swiss-Prot;Acc:Q07817]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: BCL2L1-P_pygmaeus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | BH4 | 1 | 27 |
PFAM A | Bcl-2 | 90 | 188 |
Protein sequence [+]
BCL2L1 | Pongo pygmaeus | 9600 | length:233
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | IEA |
GO:0034097 | response to cytokine stimulus | biological_proccess | IEA |
GO:0051881 | regulation of mitochondrial membrane potential | biological_proccess | IEA |
GO:0046902 | regulation of mitochondrial membrane permeability | biological_proccess | IEA |
GO:0001701 | in utero embryonic development | biological_proccess | IEA |
GO:0007281 | germ cell development | biological_proccess | IEA |
GO:0007283 | spermatogenesis | biological_proccess | IEA |
GO:0001541 | ovarian follicle development | biological_proccess | IEA |
GO:0045768 | positive regulation of anti-apoptosis | biological_proccess | IEA |
GO:0008284 | positive regulation of cell proliferation | biological_proccess | IEA |
GO:0009566 | fertilization | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0043524 | negative regulation of neuron apoptosis | biological_proccess | IEA |
GO:0008584 | male gonad development | biological_proccess | IEA |
GO:0051789 | response to protein stimulus | biological_proccess | IEA |
GO:0009314 | response to radiation | biological_proccess | IEA |
GO:0040007 | growth | biological_proccess | IEA |
GO:0046898 | response to cycloheximide | biological_proccess | IEA |
GO:0042802 | identical protein binding | mollecular_function | IEA |
GO:0046982 | protein heterodimerization activity | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005622 | intracellular | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0031966 | mitochondrial membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSPPYG00000010890
- Expression info from Arrayexpress [?] : ENSPPYG00000010890
- Protein expression from Protein Atlas: [?] ENSPPYG00000010890
Click on [?] for more information.