BCLX_CHICK (Gallus gallus)
Description [+]
- Synonyms: BCLX_CHICK
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Aves; Gallus gallus
- Short gene description: Apoptosis regulator Bcl-X (Bcl-2-like 1 protein). [Source:UniProtKB/Swiss-Prot;Acc:Q07816]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: BCLX_CHICK-G_gallus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | BH4 | 1 | 27 |
PFAM A | Bcl-2 | 86 | 184 |
Protein sequence [+]
BCLX_CHICK | Gallus gallus | 9031 | length:229
MSSSNRELVIDFVSYKLSQRGHCWSELEEEDENRTDTAAEAEMDSVLNGSPSWHPPAGHV
VNGATVHRSSLEVHEIVRASDVRQALRDAGDEFELRYRRAFSDLTSQLHITPGTAYQSFE
QVVNELFHDGVNWGRIVAFFSFGGALCVESVDKEMRVLVGRIVSWMTTYLTDHLDPWIQE
NGGWERFVDLYGNNAAAELRKGQETFNKWLLTGATVAGVLLLGSLLSRK
VNGATVHRSSLEVHEIVRASDVRQALRDAGDEFELRYRRAFSDLTSQLHITPGTAYQSFE
QVVNELFHDGVNWGRIVAFFSFGGALCVESVDKEMRVLVGRIVSWMTTYLTDHLDPWIQE
NGGWERFVDLYGNNAAAELRKGQETFNKWLLTGATVAGVLLLGSLLSRK
Structure links:
- Smartdomain prediction information: SM00337
- Smartdomain prediction information: SM00265
- Prosite motif and domain information: PS01080
- Prosite motif and domain information: PS01259
- Prosite motif and domain information: PS01258
- Prosite motif and domain information: PS01260
- Interpro domain information: Q07816
- PFAM domain and domain family information: Q07816
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0001541 | ovarian follicle development | biological_proccess | IEA |
GO:0001701 | in utero embryonic development | biological_proccess | IEA |
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IEA |
GO:0007281 | germ cell development | biological_proccess | IEA |
GO:0007283 | spermatogenesis | biological_proccess | IEA |
GO:0008284 | positive regulation of cell proliferation | biological_proccess | IEA |
GO:0008584 | male gonad development | biological_proccess | IEA |
GO:0009314 | response to radiation | biological_proccess | IEA |
GO:0009566 | fertilization | biological_proccess | IEA |
GO:0040007 | growth | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0043524 | negative regulation of neuron apoptosis | biological_proccess | IEA |
GO:0045768 | positive regulation of anti-apoptosis | biological_proccess | IEA |
GO:0046898 | response to cycloheximide | biological_proccess | IEA |
GO:0051789 | response to protein stimulus | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | IEA |
GO:0034097 | response to cytokine stimulus | biological_proccess | IEA |
GO:0051881 | regulation of mitochondrial membrane potential | biological_proccess | IEA |
GO:0046902 | regulation of mitochondrial membrane permeability | biological_proccess | IEA |
GO:0046982 | protein heterodimerization activity | mollecular_function | IEA |
GO:0042802 | identical protein binding | mollecular_function | IEA |
GO:0005622 | intracellular | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0031966 | mitochondrial membrane | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0031965 | nuclear membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSGALG00000006211
- Expression info from Arrayexpress [?] : ENSGALG00000006211
- Protein expression from Protein Atlas: [?] ENSGALG00000006211
- entrezgene: 373954
- refseq_dna: NM_001025304
- refseq_peptide: NP_001020475
Click on [?] for more information.