NP_001003072.1 (Canis lupus familiaris)
Description [+]
- Synonyms: NP_001003072.1
- Species: Canis lupus familiaris
- Short gene description: BCL2-like 1 [Source:RefSeq_peptide;Acc:NP_001003072]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NP_001003072.1-C_familiaris
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | BH4 | 1 | 27 |
PFAM A | Bcl-2 | 90 | 188 |
Protein sequence [+]
NP_001003072.1 | Canis lupus familiaris | 9615 | length:233
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0001541 | ovarian follicle development | biological_proccess | IEA |
GO:0001701 | in utero embryonic development | biological_proccess | IEA |
GO:0007281 | germ cell development | biological_proccess | IEA |
GO:0007283 | spermatogenesis | biological_proccess | IEA |
GO:0008284 | positive regulation of cell proliferation | biological_proccess | IEA |
GO:0008584 | male gonad development | biological_proccess | IEA |
GO:0009314 | response to radiation | biological_proccess | IEA |
GO:0009566 | fertilization | biological_proccess | IEA |
GO:0040007 | growth | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0043524 | negative regulation of neuron apoptosis | biological_proccess | IEA |
GO:0045768 | positive regulation of anti-apoptosis | biological_proccess | IEA |
GO:0046898 | response to cycloheximide | biological_proccess | IEA |
GO:0051789 | response to protein stimulus | biological_proccess | IEA |
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IEA |
GO:0006916 | anti-apoptosis | biological_proccess | IEA |
GO:0034097 | response to cytokine stimulus | biological_proccess | IEA |
GO:0051881 | regulation of mitochondrial membrane potential | biological_proccess | IEA |
GO:0046902 | regulation of mitochondrial membrane permeability | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0046982 | protein heterodimerization activity | mollecular_function | IEA |
GO:0042802 | identical protein binding | mollecular_function | IEA |
GO:0005622 | intracellular | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0031966 | mitochondrial membrane | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSCAFG00000007053
- Expression info from Arrayexpress [?] : ENSCAFG00000007053
- Protein expression from Protein Atlas: [?] ENSCAFG00000007053
- entrezgene: 403618
- refseq_dna: NM_001003072
- refseq_peptide: NP_001003072
Click on [?] for more information.