ENSTRUG00000016263 (Takifugu rubripes)
Description [+]
- Synonyms:
- Species: Takifugu rubripes
- Short gene description:
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: -T_rubripes
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Pkinase | 25 | 309 |
PFAM A | Pkinase_Tyr | 25 | 251 |
Protein sequence [+]
| Takifugu rubripes | 31033 | length:360
MSHEERPNFYRQDVNKTIWEVPERYQNLSPVGSGAYGSVCSADDIKTGLKIAVKKLSRPF
QSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATSLKEFNDVYLVTHLMGADLNNIVKC
QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPGNLAVNEDCELKILDFGLARHTDDEM
TGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLT
GTPPASLISRMPSHEARNYINSLPCMPKRNFADVFLGANPLAVDLLEKMLVLDTDKRITA
AEALAHPYFTQYHDPDDEPVAEPLDQSFESRDLEIEEWKRLTHEEVSSFEPPLFDEDDME
QSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATSLKEFNDVYLVTHLMGADLNNIVKC
QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPGNLAVNEDCELKILDFGLARHTDDEM
TGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLT
GTPPASLISRMPSHEARNYINSLPCMPKRNFADVFLGANPLAVDLLEKMLVLDTDKRITA
AEALAHPYFTQYHDPDDEPVAEPLDQSFESRDLEIEEWKRLTHEEVSSFEPPLFDEDDME
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IEA |
GO:0006950 | response to stress | biological_proccess | IEA |
GO:0040016 | embryonic cleavage | biological_proccess | IEA |
GO:0007243 | protein kinase cascade | biological_proccess | IEA |
GO:0004672 | protein kinase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0004713 | protein tyrosine kinase activity | mollecular_function | IEA |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IEA |
GO:0004707 | MAP kinase activity | mollecular_function | IEA |
GO:0008339 | MP kinase activity | mollecular_function | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSTRUG00000016263
- Expression info from Arrayexpress [?] : ENSTRUG00000016263
- Protein expression from Protein Atlas: [?] ENSTRUG00000016263
Click on [?] for more information.