CYC7 (Saccharomyces cerevisiae)
Description [+]
- Synonyms: CYC7
- Species: Saccharomyces cerevisiae
- Short gene description: Cytochrome c iso-2. [Source:UniProtKB/Swiss-Prot;Acc:P00045]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CYC7-S_cerevisiae
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | Cytochrom_C | 13 | 112 |
Protein sequence [+]
CYC7 | Saccharomyces cerevisiae | 4932 | length:113
MAKESTGFKPGSAKKGATLFKTRCQQCHTIEEGGPNKVGPNLHGIFGRHSGQVKGYSYTD
ANINKNVKWDEDSMSEYLTNPKKYIPGTKMAFAGLKKEKDRNDLITYMTKAAK
ANINKNVKWDEDSMSEYLTNPKKYIPGTKMAFAGLKKEKDRNDLITYMTKAAK
Evolution [+]
Explore tree at phylomeDB: Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0006810 | transport | biological_proccess | IEA |
| GO:0005506 | iron ion binding | mollecular_function | IEA |
| GO:0009055 | electron carrier activity | mollecular_function | IEA |
| GO:0020037 | heme binding | mollecular_function | IEA |
| GO:0046872 | metal ion binding | mollecular_function | IEA |
| GO:0005739 | mitochondrion | cell_component | IEA |
| GO:0005746 | mitochondrial respiratory chain | cell_component | IEA |
| GO:0005758 | mitochondrial intermembrane space | cell_component | IDA |
Check GO Evidence Codes here
