PRDX1 (Rattus norvegicus)
Description [+]
- Synonyms: PRDX1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Peroxiredoxin-1 (EC 1.11.1.15) (Thioredoxin peroxidase 2) (Thioredoxin-dependent peroxide reductase 2) (Heme-binding 23 kDa protein) (HBP23). [Source:UniProtKB/Swiss-Prot;Acc:Q63716]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: PRDX1-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | Redoxin | 7 | 163 |
| PFAM A | AhpC-TSA | 8 | 142 |
| PFAM A | 1-cysPrx_C | 152 | 195 |
Protein sequence [+]
Prdx1 | Rattus norvegicus | 10116 | length:199
MSSGNAKIGHPAPSFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFS
DRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLK
ADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPG
SDTIKPDVNKSKEYFSKQK
DRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLK
ADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPG
SDTIKPDVNKSKEYFSKQK
Evolution [+]
Explore tree at phylomeDB: Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0006979 | response to oxidative stress | biological_proccess | IDA |
| GO:0045454 | cell redox homeostasis | biological_proccess | IEA |
| GO:0055114 | oxidation reduction | biological_proccess | IEA |
| GO:0016491 | oxidoreductase activity | mollecular_function | IEA |
| GO:0020037 | heme binding | mollecular_function | IPI |
| GO:0042803 | protein homodimerization activity | mollecular_function | IDA |
| GO:0051920 | peroxiredoxin activity | mollecular_function | IEA |
| GO:0016209 | antioxidant activity | mollecular_function | IEA |
| GO:0005719 | nuclear euchromatin | cell_component | IDA |
| GO:0005730 | nucleolus | cell_component | IDA |
| GO:0005737 | cytoplasm | cell_component | IEA |
| GO:0005759 | mitochondrial matrix | cell_component | IDA |
| GO:0005782 | peroxisomal matrix | cell_component | IDA |
| GO:0005829 | cytosol | cell_component | IDA |
| GO:0042470 | melanosome | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000017194
- Expression info from Arrayexpress [?] : ENSRNOG00000017194
- Protein expression from Protein Atlas: [?] ENSRNOG00000017194
Click on [?] for more information.
