RIPK2 (Rattus norvegicus)
Description [+]
- Synonyms: RIPK2
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Ripk2 protein (Fragment). [Source:UniProtKB/TrEMBL;Acc:Q3B7U0]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: RIPK2-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Pkinase | 18 | 290 |
PFAM A | Pkinase_Tyr | 18 | 290 |
PFAM A | CARD | 436 | 523 |
Protein sequence [+]
Ripk2 | Rattus norvegicus | 10116 | length:539
MNGDAICSALPHIPYHKLADLHYLSRGASGTVSSARHADWRVRVAVKHLHIHTPLLDSER
NDILREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPEIAWPL
RFRILHEIALGVNYLHNMNPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRS
YKSAPEGGTIIYMPPENYEPGQKSRASVKHDIYSYAVIMWEVLSRKQPFEEVTNPLQIMY
SVSQGHRPNTSEENLPFDIPHRGLMISLIQSGWAQNPDERPSFLKCLIELEPVLRTFEDI
TFLEAVIQLKKSKIQSASSTIHLCDKKMDLSLNIPASHPPQEESCGSSLLSRNAGSPGTS
RSLSAPQDKGFFHGGPQDCSSSKAYHCPGNHSWDGIISVSQEAAFCDRRASSCSLTVIRP
LLVEKSSERPQPGIAQQWIQSKREAIVSQMTEACLNQSLDALLSRDLIMKEDYELISTKP
TRTAKVRQLLDTSDIQGEEFARVIVQKLKDNKQMGLQPYPEVLLVSRTPSSNVLQNKTL
NDILREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPEIAWPL
RFRILHEIALGVNYLHNMNPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRS
YKSAPEGGTIIYMPPENYEPGQKSRASVKHDIYSYAVIMWEVLSRKQPFEEVTNPLQIMY
SVSQGHRPNTSEENLPFDIPHRGLMISLIQSGWAQNPDERPSFLKCLIELEPVLRTFEDI
TFLEAVIQLKKSKIQSASSTIHLCDKKMDLSLNIPASHPPQEESCGSSLLSRNAGSPGTS
RSLSAPQDKGFFHGGPQDCSSSKAYHCPGNHSWDGIISVSQEAAFCDRRASSCSLTVIRP
LLVEKSSERPQPGIAQQWIQSKREAIVSQMTEACLNQSLDALLSRDLIMKEDYELISTKP
TRTAKVRQLLDTSDIQGEEFARVIVQKLKDNKQMGLQPYPEVLLVSRTPSSNVLQNKTL
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IEA |
GO:0032755 | positive regulation of interleukin-6 production | biological_proccess | IEA |
GO:0032760 | positive regulation of tumor necrosis factor production | biological_proccess | IEA |
GO:0032874 | positive regulation of stress-activated MAPK cascade | biological_proccess | IEA |
GO:0042098 | T cell proliferation | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0046330 | positive regulation of JNK cascade | biological_proccess | IEA |
GO:0050830 | defense response to Gram-positive bacterium | biological_proccess | IEA |
GO:0051092 | positive regulation of NF-kappaB transcription factor activity | biological_proccess | IEA |
GO:0070374 | positive regulation of ERK1 and ERK2 cascade | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0034134 | toll-like receptor 2 signaling pathway | biological_proccess | IEA |
GO:0032729 | positive regulation of interferon-gamma production | biological_proccess | IEA |
GO:0032743 | positive regulation of interleukin-2 production | biological_proccess | IEA |
GO:0032496 | response to lipopolysaccharide | biological_proccess | IEA |
GO:0043330 | response to exogenous dsRNA | biological_proccess | IEA |
GO:0032494 | response to peptidoglycan | biological_proccess | IEA |
GO:0050852 | T cell receptor signaling pathway | biological_proccess | IEA |
GO:0046641 | positive regulation of alpha-beta T cell proliferation | biological_proccess | IEA |
GO:0031663 | lipopolysaccharide-mediated signaling pathway | biological_proccess | IEA |
GO:0034142 | toll-like receptor 4 signaling pathway | biological_proccess | IEA |
GO:0070427 | nucleotide-binding oligomerization domain containing 1 signaling pathway | biological_proccess | IEA |
GO:0070431 | nucleotide-binding oligomerization domain containing 2 signaling pathway | biological_proccess | IEA |
GO:0032722 | positive regulation of chemokine production | biological_proccess | IEA |
GO:0070555 | biological_proccess | IEA | |
GO:0070391 | response to lipoteichoic acid | biological_proccess | IEA |
GO:0033091 | positive regulation of immature T cell proliferation | biological_proccess | IEA |
GO:0004672 | protein kinase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0004713 | protein tyrosine kinase activity | mollecular_function | IEA |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IEA |
GO:0050700 | CARD domain binding | mollecular_function | IEA |
GO:0030274 | LIM domain binding | mollecular_function | IEA |
GO:0005622 | intracellular | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000009389
- Expression info from Arrayexpress [?] : ENSRNOG00000009389
- Protein expression from Protein Atlas: [?] ENSRNOG00000009389
- entrezgene: 362491
Click on [?] for more information.