LTA (Rattus norvegicus)
Description [+]
- Synonyms: LTA
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Lymphotoxin-alpha precursor (LT-alpha) (TNF-beta) (Tumor necrosis factor ligand superfamily member 1). [Source:UniProtKB/Swiss-Prot;Acc:Q06332]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: LTA-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 74 | 202 |
Protein sequence [+]
Lta | Rattus norvegicus | 10116 | length:202
MTPLGRLHLLRVLSTPPVFLLGLLLALPLGAQGLSGVRFSASRTAHQPPQKHLTHGLLKP
AAHLVGYPSKQNSLLWRANTDRAFLRHGFSLNNNSLLIPTSGLYFVYSQVVFSGESCSPR
AIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLST
HTDGISHLHFSPSTVFFGAFAL
AAHLVGYPSKQNSLLWRANTDRAFLRHGFSLNNNSLLIPTSGLYFVYSQVVFSGESCSPR
AIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLST
HTDGISHLHFSPSTVFFGAFAL
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006959 | humoral immune response | biological_proccess | IEA |
GO:0007584 | response to nutrient | biological_proccess | IEP |
GO:0032496 | response to lipopolysaccharide | biological_proccess | IEP |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IMP |
GO:0048147 | negative regulation of fibroblast proliferation | biological_proccess | IDA |
GO:0048535 | lymph node development | biological_proccess | IEA |
GO:0006955 | immune response | biological_proccess | IEA |
GO:0005125 | cytokine activity | mollecular_function | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000000838
- Expression info from Arrayexpress [?] : ENSRNOG00000000838
- Protein expression from Protein Atlas: [?] ENSRNOG00000000838
Click on [?] for more information.