MAPK14 (Mus musculus)
Description [+]
- Synonyms: MAPK14
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: mitogen-activated protein kinase 14 Gene [Source:MGI (curated);Acc:Mapk14-003]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: MAPK14-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Pkinase | 24 | 308 |
PFAM A | Pkinase_Tyr | 24 | 250 |
Protein sequence [+]
Mapk14 | Mus musculus | 10090 | length:360
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Structure links:
- Smartdomain prediction information: SM00219
- Smartdomain prediction information: SM00220
- Prosite motif and domain information: PS00107
- Prosite motif and domain information: PS01351
- Interpro domain information: P47811
- PFAM domain and domain family information: P47811
- Protein 3D structures from PDB: 1LEW
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IEA |
GO:0000077 | DNA damage checkpoint | biological_proccess | IMP |
GO:0000902 | cell morphogenesis | biological_proccess | IGI |
GO:0001525 | angiogenesis | biological_proccess | IMP |
GO:0002062 | chondrocyte differentiation | biological_proccess | IDA |
GO:0006006 | glucose metabolic process | biological_proccess | IMP |
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IDA |
GO:0007519 | skeletal muscle development | biological_proccess | IMP |
GO:0019395 | fatty acid oxidation | biological_proccess | IMP |
GO:0031663 | lipopolysaccharide-mediated signaling pathway | biological_proccess | IDA |
GO:0032495 | response to muramyl dipeptide | biological_proccess | IDA |
GO:0032496 | response to lipopolysaccharide | biological_proccess | IDA |
GO:0045648 | positive regulation of erythrocyte differentiation | biological_proccess | IMP |
GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | biological_proccess | IMP |
GO:0006950 | response to stress | biological_proccess | IDA |
GO:0007243 | protein kinase cascade | biological_proccess | IDA |
GO:0046777 | protein amino acid autophosphorylation | biological_proccess | IEA |
GO:0051403 | stress-activated MAPK cascade | biological_proccess | IEA |
GO:0004672 | protein kinase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0004713 | protein tyrosine kinase activity | mollecular_function | IEA |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IEA |
GO:0004707 | MAP kinase activity | mollecular_function | IEA |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0004707 | MAP kinase activity | mollecular_function | IDA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0008339 | MP kinase activity | mollecular_function | ISS |
GO:0016301 | kinase activity | mollecular_function | IDA |
GO:0004672 | protein kinase activity | mollecular_function | IDA |
GO:0008022 | protein C-terminus binding | mollecular_function | IEA |
GO:0000922 | spindle pole | cell_component | IDA |
GO:0005623 | cell | cell_component | IDA |
GO:0005634 | nucleus | cell_component | IDA |
GO:0005737 | cytoplasm | cell_component | IDA |
GO:0005625 | soluble fraction | cell_component | IEA |
GO:0044445 | cytosolic part | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from MGI [?] MGI:1346865
- Ensembl genome browser [?] : ENSMUSG00000053436
- Expression info from Arrayexpress [?] : ENSMUSG00000053436
- Protein expression from Protein Atlas: [?] ENSMUSG00000053436
- Community gene edition from Wikigenes: [?] 26416
Click on [?] for more information.