SNRPA1 (Mus musculus)
Description [+]
- Synonyms: SNRPA1
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: small nuclear ribonucleoprotein polypeptide A' Gene [Source:MGI (curated);Acc:Snrpa1-001]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: SNRPA1-M_musculus
Structure & Sequence [+]
Protein sequence [+]
Snrpa1 | Mus musculus | 10090 | length:255
MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGF
PLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSI
LRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKT
FNPGAGLPTDKKKGGPSAGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPSD
EGEEEIEDDTVTNGS
PLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSI
LRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKT
FNPGAGLPTDKKKGGPSAGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPSD
EGEEEIEDDTVTNGS
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006397 | mRNA processing | biological_proccess | IEA |
GO:0008380 | RNA splicing | biological_proccess | IEA |
GO:0003723 | RNA binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005681 | spliceosome | cell_component | IEA |
GO:0030529 | ribonucleoprotein complex | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from MGI [?] MGI:1916231
- Ensembl genome browser [?] : ENSMUSG00000030512
- Expression info from Arrayexpress [?] : ENSMUSG00000030512
- Protein expression from Protein Atlas: [?] ENSMUSG00000030512
- Community gene edition from Wikigenes: [?] 68981
Click on [?] for more information.