TNFSF11 (Mus musculus)
Description [+]
- Synonyms: TNFSF11
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: tumor necrosis factor (ligand) superfamily, member 11 Gene [Source:MGI Symbol;Acc:MGI:1100089]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFSF11-M_musculus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 184 | 312 |
Protein sequence [+]
Tnfsf11 | Mus musculus | 10090 | length:316
MRRASRDYGKYLRSSEEMGSGPGVPHEGPLHPAPSAPAPAPPPAASRSMFLALLGLGLGQ
VVCSIALFLYFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQ
AFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHK
VTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVY
VVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDP
DQDATYFGAFKVQDID
VVCSIALFLYFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQ
AFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHK
VTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVY
VVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDP
DQDATYFGAFKVQDID
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006955 | immune response | biological_proccess | IEA |
GO:0001503 | ossification | biological_proccess | IMP |
GO:0009887 | organ morphogenesis | biological_proccess | IMP |
GO:0045453 | bone resorption | biological_proccess | IDA |
GO:0045672 | positive regulation of osteoclast differentiation | biological_proccess | IGI |
GO:0048535 | lymph node development | biological_proccess | TAS |
GO:0051260 | protein homooligomerization | biological_proccess | IDA |
GO:0007275 | multicellular organismal development | biological_proccess | IEA |
GO:0030154 | cell differentiation | biological_proccess | IEA |
GO:0030316 | osteoclast differentiation | biological_proccess | IDA |
GO:0045670 | regulation of osteoclast differentiation | biological_proccess | IDA |
GO:0006950 | response to stress | biological_proccess | IEA |
GO:0009314 | response to radiation | biological_proccess | IEA |
GO:0045672 | positive regulation of osteoclast differentiation | biological_proccess | IEA |
GO:0045780 | positive regulation of bone resorption | biological_proccess | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0005125 | cytokine activity | mollecular_function | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from MGI [?] MGI:1100089
- Ensembl genome browser [?] : ENSMUSG00000022015
- Expression info from Arrayexpress [?] : ENSMUSG00000022015
- Protein expression from Protein Atlas: [?] ENSMUSG00000022015
- Community gene edition from Wikigenes: [?] 21943
Click on [?] for more information.