GABARAP (Mus musculus)
Description [+]
- Synonyms: GABARAP
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Mus musculus
- Short gene description: Gamma-aminobutyric acid receptor-associated protein (GABA(A) receptor-associated protein) [Source:UniProtKB/Swiss-Prot;Acc:Q9DCD6]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: GABARAP-M_musculus
Structure & Sequence [+]
Protein sequence [+]
Gabarap | Mus musculus | 10090 | length:117
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0000226 | microtubule cytoskeleton organization | biological_proccess | IDA |
GO:0015031 | protein transport | biological_proccess | IEA |
GO:0006810 | transport | biological_proccess | IEA |
GO:0000045 | autophagic vacuole formation | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0008017 | microtubule binding | mollecular_function | IDA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0048487 | beta-tubulin binding | mollecular_function | IEA |
GO:0050811 | GABA receptor binding | mollecular_function | IEA |
GO:0005764 | lysosome | cell_component | IDA |
GO:0005790 | smooth endoplasmic reticulum | cell_component | IDA |
GO:0005794 | Golgi apparatus | cell_component | IDA |
GO:0005875 | microtubule associated complex | cell_component | IDA |
GO:0005886 | plasma membrane | cell_component | IDA |
GO:0015629 | actin cytoskeleton | cell_component | IDA |
GO:0000139 | Golgi membrane | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005874 | microtubule | cell_component | IEA |
GO:0005856 | cytoskeleton | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
GO:0000421 | autophagic vacuole membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSMUSG00000018567
- Expression info from Arrayexpress [?] : ENSMUSG00000018567
- Protein expression from Protein Atlas: [?] ENSMUSG00000018567
Click on [?] for more information.