TNFL6_MACMU (Macaca mulatta)
Description [+]
- Synonyms: TNFL6_MACMU
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Cercopithecidae; Macaca mulatta
- Short gene description: Tumor necrosis factor ligand superfamily member 6 (Fas antigen ligand) (Fas ligand) (CD178 antigen) (CD95L protein) [Contains: Tumor necrosis factor ligand superfamily member 6, membrane form; Tumor necrosis factor ligand superfamily member 6, soluble for [Source:UniProtKB/Swiss-Prot;Acc:P63307]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFL6_MACMU-M_mulatta
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
| Source | Domain Name | Start | End |
|---|---|---|---|
| PFAM A | TNF | 159 | 280 |
Protein sequence [+]
TNFL6_MACMU | Macaca mulatta | 9544 | length:280
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPP
PLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQK
HTASSLEKQIGHPSPPPEKKEQRKVAHLTGKPNSRSMPLEWEDTYGIVLLSGVKYKKGGL
VINETGLYFVYSKVYFRGQSCTNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWAH
SSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
PLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQK
HTASSLEKQIGHPSPPPEKKEQRKVAHLTGKPNSRSMPLEWEDTYGIVLLSGVKYKKGGL
VINETGLYFVYSKVYFRGQSCTNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWAH
SSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Structure links:
Evolution [+]
Explore tree at phylomeDB: Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
| GO id | Name | Ontology type | Evidence |
|---|---|---|---|
| GO:0006915 | apoptosis | biological_proccess | IEA |
| GO:0006955 | immune response | biological_proccess | IEA |
| GO:0007165 | signal transduction | biological_proccess | IEA |
| GO:0007155 | cell adhesion | biological_proccess | IEA |
| GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
| GO:0070265 | necrotic cell death | biological_proccess | IEA |
| GO:0008624 | induction of apoptosis by extracellular signals | biological_proccess | IEA |
| GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
| GO:0046666 | retinal cell programmed cell death | biological_proccess | IEA |
| GO:0007186 | G-protein coupled receptor protein signaling pathway | biological_proccess | IEA |
| GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
| GO:0005125 | cytokine activity | mollecular_function | IEA |
| GO:0005198 | structural molecule activity | mollecular_function | IEA |
| GO:0005576 | extracellular region | cell_component | IEA |
| GO:0016020 | membrane | cell_component | IEA |
| GO:0005615 | extracellular space | cell_component | IEA |
| GO:0005886 | plasma membrane | cell_component | IEA |
| GO:0016021 | integral to membrane | cell_component | IEA |
| GO:0015629 | actin cytoskeleton | cell_component | IEA |
| GO:0009897 | external side of plasma membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSMMUG00000007285
- Expression info from Arrayexpress [?] : ENSMMUG00000007285
- Protein expression from Protein Atlas: [?] ENSMMUG00000007285
- entrezgene: 574159
- refseq_dna: NM_001032838
- refseq_peptide: NP_001028010
Click on [?] for more information.
