TNFRSF4 (Homo sapiens)
Description [+]
- Synonyms: TNFRSF4
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Tumor necrosis factor receptor superfamily member 4 Precursor (OX40L receptor)(ACT35 antigen)(TAX transcriptionally-activated glycoprotein 1 receptor)(CD134 antigen) [Source:UniProtKB/Swiss-Prot;Acc:P43489]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFRSF4-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNFR_c6 | 31 | 64 |
PFAM A | TNFR_c6 | 67 | 107 |
Protein sequence [+]
TNFRSF4 | Homo sapiens | 9606 | length:277
MCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQ
NTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYK
PGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQ
GPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGPLAILLALYLL
RRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI
NTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYK
PGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQ
GPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGPLAILLALYLL
RRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006813 | potassium ion transport | biological_proccess | IEA |
GO:0042098 | T cell proliferation | biological_proccess | ISS |
GO:0030890 | positive regulation of B cell proliferation | biological_proccess | ISS |
GO:0043433 | negative regulation of transcription factor activity | biological_proccess | ISS |
GO:0032582 | negative regulation of gene-specific transcription | biological_proccess | ISS |
GO:0051024 | positive regulation of immunoglobulin secretion | biological_proccess | ISS |
GO:0006955 | immune response | biological_proccess | TAS |
GO:0042098 | T cell proliferation | biological_proccess | IEA |
GO:0006954 | inflammatory response | biological_proccess | IEA |
GO:0042981 | regulation of apoptosis | biological_proccess | IEA |
GO:0030890 | positive regulation of B cell proliferation | biological_proccess | IEA |
GO:0045859 | regulation of protein kinase activity | biological_proccess | IEA |
GO:0006968 | cellular defense response | biological_proccess | IEA |
GO:0050710 | negative regulation of cytokine secretion | biological_proccess | IEA |
GO:0051024 | positive regulation of immunoglobulin secretion | biological_proccess | IEA |
GO:0043433 | negative regulation of transcription factor activity | biological_proccess | IEA |
GO:0032582 | negative regulation of gene-specific transcription | biological_proccess | IEA |
GO:0004872 | receptor activity | mollecular_function | IEA |
GO:0005249 | voltage-gated potassium channel activity | mollecular_function | IEA |
GO:0005031 | tumor necrosis factor receptor activity | mollecular_function | TAS |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005031 | tumor necrosis factor receptor activity | mollecular_function | IEA |
GO:0016021 | integral to membrane | cell_component | IEA |
GO:0009986 | cell surface | cell_component | ISS |
GO:0005887 | integral to plasma membrane | cell_component | TAS |
GO:0016020 | membrane | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | IEA |
GO:0009897 | external side of plasma membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from HGNC [?] :11918
- Gene related info from GeneCards [?] : TNFRSF4
- Ensembl genome browser [?] : ENSG00000186827
- Expression info from Arrayexpress [?] : ENSG00000186827
- Protein expression from Protein Atlas: [?] ENSG00000186827
- Community gene edition from Wikigenes: [?] 7293
- OMIM gene information: 600315
- OMIM disease information:
Click on [?] for more information.