GABARAP (Homo sapiens)
Description [+]
- Synonyms: GABARAP
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Gamma-aminobutyric acid receptor-associated protein (GABA(A) receptor-associated protein)(MM46) [Source:UniProtKB/Swiss-Prot;Acc:O95166]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: GABARAP-H_sapiens
Structure & Sequence [+]
Protein sequence [+]
GABARAP | Homo sapiens | 9606 | length:117
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0000226 | microtubule cytoskeleton organization | biological_proccess | IEA |
GO:0006605 | protein targeting | biological_proccess | TAS |
GO:0007268 | synaptic transmission | biological_proccess | TAS |
GO:0015031 | protein transport | biological_proccess | IEA |
GO:0000045 | autophagic vacuole formation | biological_proccess | IEA |
GO:0008017 | microtubule binding | mollecular_function | IEA |
GO:0050811 | GABA receptor binding | mollecular_function | IPI |
GO:0048487 | beta-tubulin binding | mollecular_function | IDA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005764 | lysosome | cell_component | IEA |
GO:0005790 | smooth endoplasmic reticulum | cell_component | IEA |
GO:0005875 | microtubule associated complex | cell_component | IEA |
GO:0015629 | actin cytoskeleton | cell_component | IEA |
GO:0005886 | plasma membrane | cell_component | TAS |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005794 | Golgi apparatus | cell_component | IEA |
GO:0005874 | microtubule | cell_component | IEA |
GO:0000139 | Golgi membrane | cell_component | IEA |
GO:0000421 | autophagic vacuole membrane | cell_component | IDA |
GO:0005886 | plasma membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSG00000170296
- Expression info from Arrayexpress [?] : ENSG00000170296
- Protein expression from Protein Atlas: [?] ENSG00000170296
Click on [?] for more information.