LYN (Homo sapiens)
Description [+]
- Synonyms: LYN
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Tyrosine-protein kinase Lyn (EC 2.7.10.2) [Source:UniProtKB/Swiss-Prot;Acc:P07948]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: LYN-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | SH3_1 | 136 | 191 |
PFAM A | SH3_2 | 137 | 191 |
PFAM A | SH2 | 199 | 281 |
PFAM A | Pkinase | 317 | 570 |
PFAM A | Pkinase_Tyr | 317 | 567 |
Protein sequence [+]
LYN | Homo sapiens | 9606 | length:582
VPLPPRRAALPLAPRPWRLRARRAAASSPRQAGRPRHPRPRASSPSPRVQRSRPAASPYA
GPAGPPRRAPHSELKSPWSSAAPKLSPRAGNMGCIKSKGKDSLSDDGVDLKTQPVPESQL
LPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKE
GFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVR
DFDPVHGDVIKHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPK
PQKPWDKDAWEIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEE
ANLMKTLQHDKLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQ
IAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWT
APEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPD
ELYDIMKMCWKEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
GPAGPPRRAPHSELKSPWSSAAPKLSPRAGNMGCIKSKGKDSLSDDGVDLKTQPVPESQL
LPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKE
GFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVR
DFDPVHGDVIKHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPK
PQKPWDKDAWEIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEE
ANLMKTLQHDKLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQ
IAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWT
APEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPD
ELYDIMKMCWKEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
Structure links:
- Smartdomain prediction information: SM00326
- Smartdomain prediction information: SM00252
- Smartdomain prediction information: SM00219
- Smartdomain prediction information: SM00220
- Prosite motif and domain information: PS00107
- Prosite motif and domain information: PS00109
- Profile motif and domain profile information: PS50001
- Profile motif and domain profile information: PS50002
- Profile motif and domain profile information: PS50011
- Interpro domain information: P07948
- PFAM domain and domain family information: P07948
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IEA |
GO:0006468 | protein amino acid phosphorylation | biological_proccess | TAS |
GO:0007165 | signal transduction | biological_proccess | TAS |
GO:0044419 | interspecies interaction between organisms | biological_proccess | IEA |
GO:0009725 | response to hormone stimulus | biological_proccess | ISS |
GO:0030218 | erythrocyte differentiation | biological_proccess | ISS |
GO:0042531 | positive regulation of tyrosine phosphorylation of STAT protein | biological_proccess | ISS |
GO:0008284 | positive regulation of cell proliferation | biological_proccess | ISS |
GO:0009743 | response to carbohydrate stimulus | biological_proccess | IEA |
GO:0014070 | response to organic cyclic substance | biological_proccess | IEA |
GO:0042493 | response to drug | biological_proccess | IEA |
GO:0043200 | response to amino acid stimulus | biological_proccess | IEA |
GO:0051789 | response to protein stimulus | biological_proccess | IEA |
GO:0009636 | response to toxin | biological_proccess | IEA |
GO:0031668 | cellular response to extracellular stimulus | biological_proccess | IEA |
GO:0002553 | histamine secretion by mast cell | biological_proccess | IEA |
GO:0032868 | response to insulin stimulus | biological_proccess | IEA |
GO:0060252 | positive regulation of glial cell proliferation | biological_proccess | IEA |
GO:0048678 | response to axon injury | biological_proccess | IEA |
GO:0042327 | positive regulation of phosphorylation | biological_proccess | IEA |
GO:0050663 | cytokine secretion | biological_proccess | IEA |
GO:0051279 | regulation of release of sequestered calcium ion into cytosol | biological_proccess | IEA |
GO:0034605 | cellular response to heat | biological_proccess | IEA |
GO:0014003 | oligodendrocyte development | biological_proccess | IEA |
GO:0006991 | response to sterol depletion | biological_proccess | IEA |
GO:0060369 | positive regulation of Fc receptor mediated stimulatory signaling pathway | biological_proccess | IEA |
GO:0070447 | positive regulation of oligodendrocyte progenitor proliferation | biological_proccess | IEA |
GO:0007242 | intracellular signaling cascade | biological_proccess | IEA |
GO:0008284 | positive regulation of cell proliferation | biological_proccess | IEA |
GO:0018108 | peptidyl-tyrosine phosphorylation | biological_proccess | IEA |
GO:0030218 | erythrocyte differentiation | biological_proccess | IEA |
GO:0009725 | response to hormone stimulus | biological_proccess | IEA |
GO:0050853 | B cell receptor signaling pathway | biological_proccess | IEA |
GO:0042531 | positive regulation of tyrosine phosphorylation of STAT protein | biological_proccess | IEA |
GO:0004672 | protein kinase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0004713 | protein tyrosine kinase activity | mollecular_function | IEA |
GO:0004716 | receptor signaling protein tyrosine kinase activity | mollecular_function | TAS |
GO:0004715 | non-membrane spanning protein tyrosine kinase activity | mollecular_function | IEA |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IEA |
GO:0031625 | ubiquitin protein ligase binding | mollecular_function | IEA |
GO:0051219 | phosphoprotein binding | mollecular_function | IEA |
GO:0005161 | platelet-derived growth factor receptor binding | mollecular_function | IEA |
GO:0005178 | integrin binding | mollecular_function | IEA |
GO:0043208 | glycosphingolipid binding | mollecular_function | IEA |
GO:0005886 | plasma membrane | cell_component | EXP |
GO:0005634 | nucleus | cell_component | ISS |
GO:0005737 | cytoplasm | cell_component | ISS |
GO:0045121 | membrane raft | cell_component | IDA |
GO:0005794 | Golgi apparatus | cell_component | IDA |
GO:0005886 | plasma membrane | cell_component | IEA |
GO:0014069 | postsynaptic density | cell_component | IEA |
GO:0005624 | membrane fraction | cell_component | IEA |
GO:0031966 | mitochondrial membrane | cell_component | IEA |
GO:0045121 | membrane raft | cell_component | IEA |
GO:0005758 | mitochondrial intermembrane space | cell_component | IEA |
GO:0030061 | mitochondrial crista | cell_component | IEA |
GO:0034666 | alpha2-beta1 integrin complex | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Gene info from HGNC [?] :6735
- Gene related info from GeneCards [?] : LYN
- Ensembl genome browser [?] : ENSG00000147507
- Expression info from Arrayexpress [?] : ENSG00000147507
- Protein expression from Protein Atlas: [?] ENSG00000147507
- Community gene edition from Wikigenes: [?] 4067
- OMIM gene information: 165120
- OMIM disease information:
- entrezgene: 4067
- refseq_dna: NM_002350
- refseq_dna: NM_001111097
- refseq_peptide: NP_002341
- refseq_peptide: NP_001104567
Click on [?] for more information.