MAPK13 (Homo sapiens)
Description [+]
- Synonyms: MAPK13
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Primates;Hominidae; Homo sapiens
- Short gene description: Mitogen-activated protein kinase 13 (EC 2.7.11.24)(Stress-activated protein kinase 4)(Mitogen-activated protein kinase p38 delta)(MAP kinase p38 delta) [Source:UniProtKB/Swiss-Prot;Acc:O15264]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: MAPK13-H_sapiens
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Pkinase | 25 | 308 |
PFAM A | Pkinase_Tyr | 25 | 288 |
Protein sequence [+]
MAPK13 | Homo sapiens | 9606 | length:365
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGM
EFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAA
QALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKL
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGM
EFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAA
QALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKL
Structure links:
- Smartdomain prediction information: SM00219
- Smartdomain prediction information: SM00220
- Prosite motif and domain information: PS00107
- Prosite motif and domain information: PS01351
- Profile motif and domain profile information: PS50011
- Interpro domain information: O15264
- PFAM domain and domain family information: O15264
- Protein 3D structures from PDB: 3COI
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006468 | protein amino acid phosphorylation | biological_proccess | IEA |
GO:0007049 | cell cycle | biological_proccess | IEA |
GO:0007265 | Ras protein signal transduction | biological_proccess | EXP |
GO:0006950 | response to stress | biological_proccess | IDA |
GO:0007243 | protein kinase cascade | biological_proccess | IDA |
GO:0004672 | protein kinase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0004713 | protein tyrosine kinase activity | mollecular_function | IEA |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IEA |
GO:0004707 | MAP kinase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0004674 | protein serine/threonine kinase activity | mollecular_function | IDA |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0008339 | MP kinase activity | mollecular_function | IDA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0005625 | soluble fraction | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Gene info from HGNC [?] :6875
- Gene related info from GeneCards [?] : MAPK13
- Ensembl genome browser [?] : ENSG00000156711
- Expression info from Arrayexpress [?] : ENSG00000156711
- Protein expression from Protein Atlas: [?] ENSG00000156711
- Community gene edition from Wikigenes: [?] 5603
- OMIM gene information: 602899
- OMIM disease information:
Click on [?] for more information.