AK2 (Gallus gallus)
Description [+]
- Synonyms: AK2
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Aves; Gallus gallus
- Short gene description: Adenylate kinase isoenzyme 2, mitochondrial (AK 2)(EC 2.7.4.3)(ATP-AMP transphosphorylase 2) [Source:UniProtKB/Swiss-Prot;Acc:P54819]
- Family: Null
- Process:
- Pathways:
- Criteria: homology
- Curator comment: Null
- WIKI: AK2-G_gallus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | ADK | 32 | 189 |
PFAM A | ADK_lid | 154 | 189 |
Protein sequence [+]
AK2 | Gallus gallus | 9031 | length:189
QSVAAMAPNAQAGGGRGQAPGTGLRRGIRAVLLGPPGAGKGTQAPKLAETYCVCHLATGD
MLRAMVASGSELGKRLKETMDSGKLVSDEMVVELIENNLDTPPCKNGFLLDGFPRTVKQA
EMLDELLEKRREKLDSVIEFSIPDSLLIRRITGRLIHPASGRSYHEEFRPPKEHMKDDVT
GEPLIRRSD
MLRAMVASGSELGKRLKETMDSGKLVSDEMVVELIENNLDTPPCKNGFLLDGFPRTVKQA
EMLDELLEKRREKLDSVIEFSIPDSLLIRRITGRLIHPASGRSYHEEFRPPKEHMKDDVT
GEPLIRRSD
Structure links:
- Prosite motif and domain information: PS00113
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006139 | nucleobase, nucleoside, nucleotide and nucleic acid metabolic process | biological_proccess | IEA |
GO:0007264 | small GTPase mediated signal transduction | biological_proccess | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0019205 | nucleobase, nucleoside, nucleotide kinase activity | mollecular_function | IEA |
GO:0005525 | GTP binding | mollecular_function | IEA |
GO:0004017 | adenylate kinase activity | mollecular_function | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005743 | mitochondrial inner membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSGALG00000003597
- Expression info from Arrayexpress [?] : ENSGALG00000003597
- Protein expression from Protein Atlas: [?] ENSGALG00000003597
- entrezgene: 428227
Click on [?] for more information.