BNIP3 (Equus caballus)
Description [+]
- Synonyms: BNIP3
- Species: Equus caballus
- Short gene description: BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 [Source:UniProtKB/Swiss-Prot;Acc:Q12983]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: BNIP3-E_caballus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | BNIP3 | 1 | 179 |
Protein sequence [+]
BNIP3 | Equus caballus | 9796 | length:179
GSWVELHFSNNGNGSSVPASVSIYNGEMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQD
TNRAFETDTHSIGEKNSSQSEEDYIERRKEVESILKKNSDWIWDWSSRPENVPPKEFLFR
HPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF
TNRAFETDTHSIGEKNSSQSEEDYIERRKEVESILKKNSDWIWDWSSRPENVPPKEFLFR
HPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006309 | DNA fragmentation during apoptosis | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0006800 | oxygen and reactive oxygen species metabolic process | biological_proccess | IEA |
GO:0006338 | chromatin remodeling | biological_proccess | IEA |
GO:0051607 | defense response to virus | biological_proccess | IEA |
GO:0008634 | negative regulation of survival gene product expression | biological_proccess | IEA |
GO:0046902 | regulation of mitochondrial membrane permeability | biological_proccess | IEA |
GO:0045837 | negative regulation of membrane potential | biological_proccess | IEA |
GO:0050873 | brown fat cell differentiation | biological_proccess | IEA |
GO:0042803 | protein homodimerization activity | mollecular_function | IEA |
GO:0046982 | protein heterodimerization activity | mollecular_function | IEA |
GO:0005635 | nuclear envelope | cell_component | IEA |
GO:0031307 | integral to mitochondrial outer membrane | cell_component | IEA |
GO:0031966 | mitochondrial membrane | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSECAG00000017458
- Expression info from Arrayexpress [?] : ENSECAG00000017458
- Protein expression from Protein Atlas: [?] ENSECAG00000017458
- Community gene edition from Wikigenes: [?] 100051673
- entrezgene: 100051673
Click on [?] for more information.