MUL1 (Equus caballus)
Description [+]
- Synonyms: MUL1
- Species: Equus caballus
- Short gene description: Mitochondrial ubiquitin ligase activator of NFKB 1 (EC 6.3.2.-)(E3 ubiquitin-protein ligase MUL1)(Growth inhibition and death E3 ligase)(Putative NF-kappa-B-activating protein 266)(Mitochondrial-anchored protein ligase)(RING finger protein 218) [Source:UniProtKB/Swiss-Prot;Acc:Q969V5]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: MUL1-E_caballus
Structure & Sequence [+]
Protein sequence [+]
MUL1 | Equus caballus | 9796 | length:352
MEGGGRPSLGQVILLGTSSVVTAILYSVYRQKAQVAQELKGARRIHLGEDLKSILSEAPG
KCVPYAVIEGVVRSVKETLNSQFVDNCKGVIQRLTLQEHKMVWNRTTHLWNDCSKIIHQR
TNSVPFELVPHEDGVDVAVRVLKPLDALDLGLETVYEKYHPLVQSFTDVIGHYISGERPK
GIQETEEMLKVGAALTGVGELVLDNNAVRLQPPKQGMQYYLSSQDFDSLLQGQESSARLW
KVLTLVFGFAACAALFFILWKQYLQRQERLRLKQMEEEFREHEAQLLSRAKPEDRESLKS
ACVVCLSNFKACVFLECGHVCSCAECYRALPEPKRCPICRQQITRVVPLYSS
KCVPYAVIEGVVRSVKETLNSQFVDNCKGVIQRLTLQEHKMVWNRTTHLWNDCSKIIHQR
TNSVPFELVPHEDGVDVAVRVLKPLDALDLGLETVYEKYHPLVQSFTDVIGHYISGERPK
GIQETEEMLKVGAALTGVGELVLDNNAVRLQPPKQGMQYYLSSQDFDSLLQGQESSARLW
KVLTLVFGFAACAALFFILWKQYLQRQERLRLKQMEEEFREHEAQLLSRAKPEDRESLKS
ACVVCLSNFKACVFLECGHVCSCAECYRALPEPKRCPICRQQITRVVPLYSS
Structure links:
- Smartdomain prediction information: SM00184
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0030308 | negative regulation of cell growth | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0007257 | activation of JUN kinase activity | biological_proccess | IEA |
GO:0006919 | activation of caspase activity | biological_proccess | IEA |
GO:0016567 | protein ubiquitination | biological_proccess | IEA |
GO:0000266 | mitochondrial fission | biological_proccess | IEA |
GO:0051646 | mitochondrion localization | biological_proccess | IEA |
GO:0042802 | identical protein binding | mollecular_function | IEA |
GO:0004842 | ubiquitin-protein ligase activity | mollecular_function | IEA |
GO:0004871 | signal transducer activity | mollecular_function | IEA |
GO:0031307 | integral to mitochondrial outer membrane | cell_component | IEA |
GO:0005777 | peroxisome | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSECAG00000015506
- Expression info from Arrayexpress [?] : ENSECAG00000015506
- Protein expression from Protein Atlas: [?] ENSECAG00000015506
- Community gene edition from Wikigenes: [?] 100058446
- entrezgene: 100058446
Click on [?] for more information.