P53_CANFA (Canis lupus familiaris)
Description [+]
- Synonyms: P53_CANFA
- Species: Canis lupus familiaris
- Short gene description: Cellular tumor antigen p53 (Tumor suppressor p53). [Source:UniProtKB/Swiss-Prot;Acc:Q29537]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: P53_CANFA-C_familiaris
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | P53_TAD | 7 | 31 |
PFAM A | P53 | 84 | 279 |
PFAM A | P53_tetramer | 308 | 349 |
Protein sequence [+]
P53_CANFA | Canis lupus familiaris | 9615 | length:383
AAMQEPQSELNIDPPLSQETFSELWNLLPENNVLSSELCPAVDELLLPESVVNWLDEDSD
DAPRMPATSAPTAPGPAPSWPLSSSVPSPKTYPGTYGFRLGFLHSGTAKSVTWTYSPLLN
KLFCQLAKTCPVQLWVSSPPPPNTCVRAMAIYKKSEFVTEVVRRCPHHERCSDSSDGLAP
PQHLIRVEGNLRAKYLDDRNTFRHSVVVPYEPPEVGSDYTTIHYNYMCNSSCMGGMNRRP
ILTIITLEDSSGNVLGRNSFEVRVCACPGRDRRTEEENFHKKGEPCPEPPPGSTKRALPP
STSSSPPQKKKPLDGEYFTLQIRGRERYEMFRNLNEALELKDAQSGKEPGGSRAHSSHLK
AKKGQSTSRHKKLMFKREGPDSD
DAPRMPATSAPTAPGPAPSWPLSSSVPSPKTYPGTYGFRLGFLHSGTAKSVTWTYSPLLN
KLFCQLAKTCPVQLWVSSPPPPNTCVRAMAIYKKSEFVTEVVRRCPHHERCSDSSDGLAP
PQHLIRVEGNLRAKYLDDRNTFRHSVVVPYEPPEVGSDYTTIHYNYMCNSSCMGGMNRRP
ILTIITLEDSSGNVLGRNSFEVRVCACPGRDRRTEEENFHKKGEPCPEPPPGSTKRALPP
STSSSPPQKKKPLDGEYFTLQIRGRERYEMFRNLNEALELKDAQSGKEPGGSRAHSSHLK
AKKGQSTSRHKKLMFKREGPDSD
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0000060 | protein import into nucleus, translocation | biological_proccess | IEA |
GO:0000122 | negative regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0001701 | in utero embryonic development | biological_proccess | IEA |
GO:0001836 | release of cytochrome c from mitochondria | biological_proccess | IEA |
GO:0002309 | T cell proliferation during immune response | biological_proccess | IEA |
GO:0002326 | B cell lineage commitment | biological_proccess | IEA |
GO:0002360 | T cell lineage commitment | biological_proccess | IEA |
GO:0006289 | nucleotide-excision repair | biological_proccess | IEA |
GO:0006302 | double-strand break repair | biological_proccess | IEA |
GO:0006355 | regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0006461 | protein complex assembly | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0006974 | response to DNA damage stimulus | biological_proccess | IEA |
GO:0006983 | ER overload response | biological_proccess | IEA |
GO:0007275 | multicellular organismal development | biological_proccess | IEA |
GO:0007369 | gastrulation | biological_proccess | IEA |
GO:0007406 | negative regulation of neuroblast proliferation | biological_proccess | IEA |
GO:0007417 | central nervous system development | biological_proccess | IEA |
GO:0007569 | cell aging | biological_proccess | IEA |
GO:0008104 | protein localization | biological_proccess | IEA |
GO:0008156 | negative regulation of DNA replication | biological_proccess | IEA |
GO:0008635 | activation of caspase activity by cytochrome c | biological_proccess | IEA |
GO:0009411 | response to UV | biological_proccess | IEA |
GO:0009792 | embryonic development ending in birth or egg hatching | biological_proccess | IEA |
GO:0010165 | response to X-ray | biological_proccess | IEA |
GO:0010332 | response to gamma radiation | biological_proccess | IEA |
GO:0010552 | positive regulation of specific transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0031571 | G1 DNA damage checkpoint | biological_proccess | IEA |
GO:0033077 | T cell differentiation in the thymus | biological_proccess | IEA |
GO:0042149 | cellular response to glucose starvation | biological_proccess | IEA |
GO:0042493 | response to drug | biological_proccess | IEA |
GO:0042771 | DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis | biological_proccess | IEA |
GO:0043066 | negative regulation of apoptosis | biological_proccess | IEA |
GO:0043525 | positive regulation of neuron apoptosis | biological_proccess | IEA |
GO:0045449 | regulation of transcription | biological_proccess | IEA |
GO:0045944 | positive regulation of transcription from RNA polymerase II promoter | biological_proccess | IEA |
GO:0048147 | negative regulation of fibroblast proliferation | biological_proccess | IEA |
GO:0006350 | transcription | biological_proccess | IEA |
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0007049 | cell cycle | biological_proccess | IEA |
GO:0045786 | negative regulation of cell cycle | biological_proccess | IEA |
GO:0002347 | response to tumor cell | biological_proccess | IEA |
GO:0030308 | negative regulation of cell growth | biological_proccess | IEA |
GO:0018144 | RNA-protein covalent cross-linking | biological_proccess | IEA |
GO:0045893 | positive regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0045941 | positive regulation of transcription | biological_proccess | IEA |
GO:0009303 | rRNA transcription | biological_proccess | IEA |
GO:0008285 | negative regulation of cell proliferation | biological_proccess | IEA |
GO:0042127 | regulation of cell proliferation | biological_proccess | IEA |
GO:0051726 | regulation of cell cycle | biological_proccess | IEA |
GO:0051276 | chromosome organization | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0030330 | DNA damage response, signal transduction by p53 class mediator | biological_proccess | IEA |
GO:0043523 | regulation of neuron apoptosis | biological_proccess | IEA |
GO:0046902 | regulation of mitochondrial membrane permeability | biological_proccess | IEA |
GO:0009651 | response to salt stress | biological_proccess | IEA |
GO:0034644 | cellular response to UV | biological_proccess | IEA |
GO:0000739 | DNA strand annealing activity | mollecular_function | IEA |
GO:0003677 | DNA binding | mollecular_function | IEA |
GO:0003682 | chromatin binding | mollecular_function | IEA |
GO:0003700 | transcription factor activity | mollecular_function | IEA |
GO:0005507 | copper ion binding | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0019899 | enzyme binding | mollecular_function | IEA |
GO:0046982 | protein heterodimerization activity | mollecular_function | IEA |
GO:0047485 | protein N-terminus binding | mollecular_function | IEA |
GO:0051087 | chaperone binding | mollecular_function | IEA |
GO:0008270 | zinc ion binding | mollecular_function | IEA |
GO:0046872 | metal ion binding | mollecular_function | IEA |
GO:0008134 | transcription factor binding | mollecular_function | IEA |
GO:0010843 | promoter binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0005626 | insoluble fraction | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005654 | nucleoplasm | cell_component | IEA |
GO:0005657 | replication fork | cell_component | IEA |
GO:0005730 | nucleolus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005829 | cytosol | cell_component | IEA |
GO:0016363 | nuclear matrix | cell_component | IEA |
GO:0016605 | PML body | cell_component | IEA |
GO:0005783 | endoplasmic reticulum | cell_component | IEA |
GO:0005669 | transcription factor TFIID complex | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSCAFG00000016714
- Expression info from Arrayexpress [?] : ENSCAFG00000016714
- Protein expression from Protein Atlas: [?] ENSCAFG00000016714
- entrezgene: 403869
- refseq_dna: NM_001003210
- refseq_peptide: NP_001003210
Click on [?] for more information.