TNFB_CANFA (Canis lupus familiaris)
Description [+]
- Synonyms: TNFB_CANFA
- Species: Canis lupus familiaris
- Short gene description: Lymphotoxin-alpha precursor (LT-alpha) (TNF-beta) (Tumor necrosis factor ligand superfamily member 1). [Source:UniProtKB/Swiss-Prot;Acc:Q5WR07]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TNFB_CANFA-C_familiaris
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TNF | 76 | 204 |
Protein sequence [+]
TNFB_CANFA | Canis lupus familiaris | 9615 | length:204
MTPPGRLYLLRVRSAPVLLLLGLLLGLPPGAQGFPGVGISPSAARTAYQHPQKHFIQGTL
KPAAHLIGDPSIQNSLRWRANTDRAFLRHGFSLSNNSLLVPTSGLYFVYSQVVFSGEGCF
PKATPTPLYLAHEVQLFSSQYPFHVPLLSAQKSVCPGPQGPWVRSVYQGAVFLLTQGDQL
STHTDGISHLLLSPSSVFFGAFAL
KPAAHLIGDPSIQNSLRWRANTDRAFLRHGFSLSNNSLLVPTSGLYFVYSQVVFSGEGCF
PKATPTPLYLAHEVQLFSSQYPFHVPLLSAQKSVCPGPQGPWVRSVYQGAVFLLTQGDQL
STHTDGISHLLLSPSSVFFGAFAL
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006955 | immune response | biological_proccess | IEA |
GO:0006959 | humoral immune response | biological_proccess | IEA |
GO:0048535 | lymph node development | biological_proccess | IEA |
GO:0005125 | cytokine activity | mollecular_function | IEA |
GO:0005164 | tumor necrosis factor receptor binding | mollecular_function | IEA |
GO:0005576 | extracellular region | cell_component | IEA |
GO:0005615 | extracellular space | cell_component | IEA |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSCAFG00000000515
- Expression info from Arrayexpress [?] : ENSCAFG00000000515
- Protein expression from Protein Atlas: [?] ENSCAFG00000000515
- entrezgene: 607183
Click on [?] for more information.