TRADD_BOVIN (Bos taurus)
Description [+]
- Synonyms: TRADD_BOVIN
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Ruminantia; Bos taurus
- Short gene description: Tumor necrosis factor receptor type 1-associated DEATH domain protein (TNFR1-associated DEATH domain protein)(TNFRSF1A-associated via death domain) [Source:UniProtKB/Swiss-Prot;Acc:Q2KI74]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TRADD_BOVIN-B_taurus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | TRADD_N | 51 | 161 |
PFAM A | Death | 217 | 305 |
Protein sequence [+]
TRADD_BOVIN | Bos taurus | 9913 | length:312
MAAGPNGLEEWVGSAYLFVESSLDKVVLSDAYAHQQQKVAMYGALQTALAESGGSPDVLQ
MLKIHRSDPQLIVQLRFSGRQACSRFLRAYREGALRATLQGCLARALALNSVPLQLELRA
GAEQLDALLTNEERCLNCICAQKPDRLRDEELTELENALRNLTCGSAGGQGSDVQGTPAP
LQSLAPSPPEEKPPPPQPGQTFLFQGQPIVNRPLNLQDQQKFARSVGLKWRKVGRSLQRS
CRALRDPALDSLAYEYERDGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAED
LLGLANPDGSLA
MLKIHRSDPQLIVQLRFSGRQACSRFLRAYREGALRATLQGCLARALALNSVPLQLELRA
GAEQLDALLTNEERCLNCICAQKPDRLRDEELTELENALRNLTCGSAGGQGSDVQGTPAP
LQSLAPSPPEEKPPPPQPGQTFLFQGQPIVNRPLNLQDQQKFARSVGLKWRKVGRSLQRS
CRALRDPALDSLAYEYERDGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAED
LLGLANPDGSLA
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006915 | apoptosis | biological_proccess | IEA |
GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB cascade | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0051798 | positive regulation of hair follicle development | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0004871 | signal transducer activity | mollecular_function | IEA |
GO:0070513 | death domain binding | mollecular_function | IEA |
GO:0042802 | identical protein binding | mollecular_function | IEA |
GO:0019900 | kinase binding | mollecular_function | IEA |
GO:0060090 | molecular adaptor activity | mollecular_function | IEA |
GO:0019215 | intermediate filament binding | mollecular_function | IEA |
GO:0005856 | cytoskeleton | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0043235 | receptor complex | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSBTAG00000012642
- Expression info from Arrayexpress [?] : ENSBTAG00000012642
- Protein expression from Protein Atlas: [?] ENSBTAG00000012642
- entrezgene: 504707
- refseq_dna: NM_001045896
- refseq_peptide: NP_001039361
Click on [?] for more information.