TP53 (Xenopus tropicalis)
Description [+]
- Synonyms: TP53
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Amphibia; Xenopus tropicalis
- Short gene description: Tumor protein p53 (Li-Fraumeni syndrome). [Source:UniProtKB/TrEMBL;Acc:Q6NTF1]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TP53-X_tropicalis
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | P53_TAD | 4 | 28 |
PFAM A | P53 | 69 | 264 |
PFAM A | P53_tetramer | 290 | 335 |
Protein sequence [+]
tp53 | Xenopus tropicalis | 8364 | length:364
MEPSSETGMEPPLSQETFEDLWSLLPDPLQTGTGQMENFAEFSEYPLAPDMTVLQEGLMG
NTVPTVTSSAVPSTEDYAGSYGLKLEFQQNGTAKSVTCTYSTDLNKLFCQLAKTCPLLVR
VERPPPLGSILRATAVYKKSEHVAEVVKRCPHHERSVEPGDDPAPPSHLMRVEGNSKAYY
MEDVGTGRHSVCVPYEGPQVGTECTTVLYNYMCNSSCMGGMNRRPILTIITLESPEGLLL
GRRCFEVRVCACPGRDRRTEEDNCTKKRGLKPNGKRELSHPPSSDPPLPKKRLIGSVPLT
AVTFRLQIKGRSRYEMIKKLNDALELQESLDQQKLSIKCRKCRDEIKPKKGKKLLVKDEL
QDSE
NTVPTVTSSAVPSTEDYAGSYGLKLEFQQNGTAKSVTCTYSTDLNKLFCQLAKTCPLLVR
VERPPPLGSILRATAVYKKSEHVAEVVKRCPHHERSVEPGDDPAPPSHLMRVEGNSKAYY
MEDVGTGRHSVCVPYEGPQVGTECTTVLYNYMCNSSCMGGMNRRPILTIITLESPEGLLL
GRRCFEVRVCACPGRDRRTEEDNCTKKRGLKPNGKRELSHPPSSDPPLPKKRLIGSVPLT
AVTFRLQIKGRSRYEMIKKLNDALELQESLDQQKLSIKCRKCRDEIKPKKGKKLLVKDEL
QDSE
Structure links:
- Prosite motif and domain information: PS00348
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0045893 | positive regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0006978 | DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator | biological_proccess | IEA |
GO:0000077 | DNA damage checkpoint | biological_proccess | IEA |
GO:0042771 | DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis | biological_proccess | IEA |
GO:0045786 | negative regulation of cell cycle | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0010165 | response to X-ray | biological_proccess | IEA |
GO:0009411 | response to UV | biological_proccess | IEA |
GO:0043280 | positive regulation of caspase activity | biological_proccess | IEA |
GO:0043525 | positive regulation of neuron apoptosis | biological_proccess | IEA |
GO:0051597 | response to methylmercury | biological_proccess | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0030528 | transcription regulator activity | mollecular_function | IEA |
GO:0016563 | transcription activator activity | mollecular_function | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSXETG00000025055
- Expression info from Arrayexpress [?] : ENSXETG00000025055
- Protein expression from Protein Atlas: [?] ENSXETG00000025055
Click on [?] for more information.