CYCB_FUGRU (Takifugu rubripes)
Description [+]
- Synonyms: CYCB_FUGRU
- Species: Takifugu rubripes
- Short gene description: Cytochrome c-b. [Source:UniProtKB/Swiss-Prot;Acc:Q1KKS2]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: CYCB_FUGRU-T_rubripes
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Cytochrom_C | 5 | 104 |
Protein sequence [+]
CYCB_FUGRU | Takifugu rubripes | 31033 | length:105
MSGDIAKGKKAFVQKCAQCHTVEQGGKHKTGPNLWGLFGRKTGQAEGFSYTDANKSKGII
WSEETLMVYLENPKKYIPGTKMIFAGIKKKTERADLIAYLKSSTS
WSEETLMVYLENPKKYIPGTKMIFAGIKKKTERADLIAYLKSSTS
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006810 | transport | biological_proccess | IEA |
GO:0005506 | iron ion binding | mollecular_function | IEA |
GO:0009055 | electron carrier activity | mollecular_function | IEA |
GO:0020037 | heme binding | mollecular_function | IEA |
GO:0046872 | metal ion binding | mollecular_function | IEA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005746 | mitochondrial respiratory chain | cell_component | IEA |
GO:0005759 | mitochondrial matrix | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSTRUG00000017459
- Expression info from Arrayexpress [?] : ENSTRUG00000017459
- Protein expression from Protein Atlas: [?] ENSTRUG00000017459
Click on [?] for more information.