TP53 (Takifugu rubripes)
Description [+]
- Synonyms: TP53
- Species: Takifugu rubripes
- Short gene description: Cellular tumor antigen p53 (Tumor suppressor p53)(Phosphoprotein p53)(Antigen NY-CO-13) [Source:UniProtKB/Swiss-Prot;Acc:P04637]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: TP53-T_rubripes
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | P53_TAD | 1 | 25 |
PFAM A | P53 | 65 | 256 |
PFAM A | P53_tetramer | 285 | 329 |
Protein sequence [+]
TP53 | Takifugu rubripes | 31033 | length:354
MEDEGFSLPLSQDTFQDLWENVDVCMHPDSPVSQLMNYPELPFNEELFNLPSEMASKDSA
NLSTPTVPVTTDYPGEYGFELRFQKSGTAKSVTSTYSEILNKLYCQLAKTSLVEVLLIKK
PPAGAVLRATAIYKKIEHVADVVRRCPHHQNEDSAAHRSHLIRMEGSQRAQYFEDPHTKR
QSVTVPYEPPQLGSEFTTILLSFMCNSSCMGGMNRRPILTILTLETQEGVVLGRRCFEVR
VCACPGRDRKTEEANSTNMQNGTKETKKRKSVPPPAAAAAAKKSKTASSAEEDDKELFTL
QIRGRKRYEMLKKINDGLELLENKPKCKAAAKPECPVPPRGKRLLHRGEKSDSD
NLSTPTVPVTTDYPGEYGFELRFQKSGTAKSVTSTYSEILNKLYCQLAKTSLVEVLLIKK
PPAGAVLRATAIYKKIEHVADVVRRCPHHQNEDSAAHRSHLIRMEGSQRAQYFEDPHTKR
QSVTVPYEPPQLGSEFTTILLSFMCNSSCMGGMNRRPILTILTLETQEGVVLGRRCFEVR
VCACPGRDRKTEEANSTNMQNGTKETKKRKSVPPPAAAAAAKKSKTASSAEEDDKELFTL
QIRGRKRYEMLKKINDGLELLENKPKCKAAAKPECPVPPRGKRLLHRGEKSDSD
Structure links:
- Prosite motif and domain information: PS00348
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006355 | regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0045449 | regulation of transcription | biological_proccess | IEA |
GO:0002347 | response to tumor cell | biological_proccess | IEA |
GO:0030308 | negative regulation of cell growth | biological_proccess | IEA |
GO:0045893 | positive regulation of transcription, DNA-dependent | biological_proccess | IEA |
GO:0043065 | positive regulation of apoptosis | biological_proccess | IEA |
GO:0006978 | DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator | biological_proccess | IEA |
GO:0000077 | DNA damage checkpoint | biological_proccess | IEA |
GO:0042771 | DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis | biological_proccess | IEA |
GO:0045786 | negative regulation of cell cycle | biological_proccess | IEA |
GO:0006917 | induction of apoptosis | biological_proccess | IEA |
GO:0010165 | response to X-ray | biological_proccess | IEA |
GO:0009411 | response to UV | biological_proccess | IEA |
GO:0043280 | positive regulation of caspase activity | biological_proccess | IEA |
GO:0043525 | positive regulation of neuron apoptosis | biological_proccess | IEA |
GO:0051597 | response to methylmercury | biological_proccess | IEA |
GO:0003677 | DNA binding | mollecular_function | IEA |
GO:0003700 | transcription factor activity | mollecular_function | IEA |
GO:0008270 | zinc ion binding | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0030528 | transcription regulator activity | mollecular_function | IEA |
GO:0016563 | transcription activator activity | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSTRUG00000012107
- Expression info from Arrayexpress [?] : ENSTRUG00000012107
- Protein expression from Protein Atlas: [?] ENSTRUG00000012107
Click on [?] for more information.