ANXA1 (Taeniopygia guttata)
Description [+]
- Synonyms: ANXA1
- Species: Taeniopygia guttata
- Short gene description: Annexin A1 (Annexin-1)(Annexin I)(Lipocortin I)(Calpactin II)(Chromobindin-9)(p35)(Phospholipase A2 inhibitory protein) [Taeniopygia guttata]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: ANXA1-T_guttata
Structure & Sequence [+]
Protein sequence [+]
ANXA1 | Taeniopygia guttata | 59729 | length:342
MAMVSEFLKQAWFIENQEMECIKSAKGIHGVQSYPNFDPSADVAALDRAITVKGVDEATI
IDILTKRTNAQRQQIKAAYQQTKGKSLEEALKKALKGHLEDVVVALLKTPAQFDAEELRA
SMKGLGTDEDTLIEILASRTNQEIREANRYYKEVLKRDLTQDIISDTSGDFQKALVALAK
ADRCENPHVNDELADNDARALYEAGEKRKGTDTGVFITVLTKRSYPHLRRVFQQYTKYSK
HDMNKVLDLELKGDIENCLTALVKCATSKPAFFAEKLHLAMKGAGTRHKDLIRIMVSRHE
VDLNEIKGYYKSLYGISLRQAIMDELKGDYETILVALCGSDN
IDILTKRTNAQRQQIKAAYQQTKGKSLEEALKKALKGHLEDVVVALLKTPAQFDAEELRA
SMKGLGTDEDTLIEILASRTNQEIREANRYYKEVLKRDLTQDIISDTSGDFQKALVALAK
ADRCENPHVNDELADNDARALYEAGEKRKGTDTGVFITVLTKRSYPHLRRVFQQYTKYSK
HDMNKVLDLELKGDIENCLTALVKCATSKPAFFAEKLHLAMKGAGTRHKDLIRIMVSRHE
VDLNEIKGYYKSLYGISLRQAIMDELKGDYETILVALCGSDN
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0007010 | cytoskeleton organization | biological_proccess | IEA |
GO:0007165 | signal transduction | biological_proccess | IEA |
GO:0007049 | cell cycle | biological_proccess | IEA |
GO:0042127 | regulation of cell proliferation | biological_proccess | IEA |
GO:0050482 | arachidonic acid secretion | biological_proccess | IEA |
GO:0018149 | peptide cross-linking | biological_proccess | IEA |
GO:0030216 | keratinocyte differentiation | biological_proccess | IEA |
GO:0005509 | calcium ion binding | mollecular_function | IEA |
GO:0005544 | calcium-dependent phospholipid binding | mollecular_function | IEA |
GO:0004859 | phospholipase inhibitor activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IEA |
GO:0030674 | protein binding, bridging | mollecular_function | IEA |
GO:0005198 | structural molecule activity | mollecular_function | IEA |
GO:0042383 | sarcolemma | cell_component | IEA |
GO:0001533 | cornified envelope | cell_component | IEA |
Check GO Evidence Codes here
Information from other databases [+]
- Ensembl genome browser [?] : ENSTGUG00000000793
- Expression info from Arrayexpress [?] : ENSTGUG00000000793
- Protein expression from Protein Atlas: [?] ENSTGUG00000000793
Click on [?] for more information.