NAT3 (Saccharomyces cerevisiae)
Description [+]
- Synonyms: NAT3
- Species: Saccharomyces cerevisiae
- Short gene description: N-terminal acetyltransferase B complex catalytic subunit NAT3 (EC 2.3.1.88) (NatB complex subunit NAT3) (NatB Nalpha terminal acetyltransferase 3). [Source:UniProtKB/Swiss-Prot;Acc:Q06504]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NAT3-S_cerevisiae
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Acetyltransf_1 | 53 | 135 |
Protein sequence [+]
NAT3 | Saccharomyces cerevisiae | 4932 | length:195
MTTIQPFEPVDLFKTNNVNLDILTENFPLEFYFEYMIIWPDLFFKSSEMTVDPTFKHNIS
GYMMAKTEGKTTEWHTHITAVTVAPRFRRISLASKLCNTLETMTDVMPHEVNFIDLFVKC
NNQLAIKLYEKLGYSVYRRVVGYYNSAEDGYPDTLKKVDDNKDAFDMRKAMARDRNRSVR
PDGRSHKCYPHDVRF
GYMMAKTEGKTTEWHTHITAVTVAPRFRRISLASKLCNTLETMTDVMPHEVNFIDLFVKC
NNQLAIKLYEKLGYSVYRRVVGYYNSAEDGYPDTLKKVDDNKDAFDMRKAMARDRNRSVR
PDGRSHKCYPHDVRF
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0000001 | mitochondrion inheritance | biological_proccess | IGI |
GO:0000723 | telomere maintenance | biological_proccess | IMP |
GO:0007010 | cytoskeleton organization | biological_proccess | IGI |
GO:0008152 | metabolic process | biological_proccess | IEA |
GO:0017196 | N-terminal peptidyl-methionine acetylation | biological_proccess | IMP |
GO:0004596 | peptide alpha-N-acetyltransferase activity | mollecular_function | IEA |
GO:0008080 | N-acetyltransferase activity | mollecular_function | IEA |
GO:0008415 | acyltransferase activity | mollecular_function | IEA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0031416 | NatB complex | cell_component | TAS |
Check GO Evidence Codes here