MAK3 (Saccharomyces cerevisiae)
Description [+]
- Synonyms: MAK3
- Species: Saccharomyces cerevisiae
- Short gene description: N-terminal acetyltransferase C complex catalytic subunit MAK3 (EC 2.3.1.88) (NatC compolex subunit MAK3) (L-A virus GAG protein N- acetyltransferase subunit MAK3) (Maintenance of killer protein 3). [Source:UniProtKB/Swiss-Prot;Acc:Q03503]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: MAK3-S_cerevisiae
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Acetyltransf_1 | 55 | 136 |
Protein sequence [+]
MAK3 | Saccharomyces cerevisiae | 4932 | length:176
MEIVYKPLDIRNEEQFASIKKLIDADLSEPYSIYVYRYFLNQWPELTYIAVDNKSGTPNI
PIGCIVCKMDPHRNVRLRGYIGMLAVESTYRGHGIAKKLVEIAIDKMQREHCDEIMLETE
VENSAALNLYEGMGFIRMKRMFRYYLNEGDAFKLILPLTEKSCTRSTFLMHGRLAT
PIGCIVCKMDPHRNVRLRGYIGMLAVESTYRGHGIAKKLVEIAIDKMQREHCDEIMLETE
VENSAALNLYEGMGFIRMKRMFRYYLNEGDAFKLILPLTEKSCTRSTFLMHGRLAT
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0000723 | telomere maintenance | biological_proccess | IMP |
GO:0006474 | N-terminal protein amino acid acetylation | biological_proccess | IMP |
GO:0008152 | metabolic process | biological_proccess | IEA |
GO:0004596 | peptide alpha-N-acetyltransferase activity | mollecular_function | IEA |
GO:0005515 | protein binding | mollecular_function | IPI |
GO:0008080 | N-acetyltransferase activity | mollecular_function | IEA |
GO:0008415 | acyltransferase activity | mollecular_function | IEA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0031417 | NatC complex | cell_component | IDA |
Check GO Evidence Codes here