NUC1 (Saccharomyces cerevisiae)
Description [+]
- Synonyms: NUC1
- Species: Saccharomyces cerevisiae
- Short gene description: Mitochondrial nuclease (EC 3.1.30.-). [Source:UniProtKB/Swiss-Prot;Acc:P08466]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: NUC1-S_cerevisiae
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | Endonuclease_NS | 73 | 290 |
Protein sequence [+]
NUC1 | Saccharomyces cerevisiae | 4932 | length:329
MCSRILLSGLVGLGAGTGLTYLLLNKHSPTQIIETPYPPTQKPNSNIQSHSFNVDPSGFF
KYGFPGPIHDLQNREEFISCYNRQTQNPYWVLEHITPESLAARNADRKNSFFKEDEVIPE
KFRGKLRDYFRSGYDRGHQAPAADAKFSQQAMDDTFYLSNMCPQVGEGFNRDYWAHLEYF
CRGLTKKYKSVRIVTGPLYLPKKDPIDNKFRVNYEVIGNPPSIAVPTHFFKLIVAEAPTA
NPAREDIAVAAFVLPNEPISNETKLTDFEVPIDALERSTGLELLQKVPPSKKKALCKEVN
CQIVVRDFSNAAIKQSKDVKLLPPPKKRN
KYGFPGPIHDLQNREEFISCYNRQTQNPYWVLEHITPESLAARNADRKNSFFKEDEVIPE
KFRGKLRDYFRSGYDRGHQAPAADAKFSQQAMDDTFYLSNMCPQVGEGFNRDYWAHLEYF
CRGLTKKYKSVRIVTGPLYLPKKDPIDNKFRVNYEVIGNPPSIAVPTHFFKLIVAEAPTA
NPAREDIAVAAFVLPNEPISNETKLTDFEVPIDALERSTGLELLQKVPPSKKKALCKEVN
CQIVVRDFSNAAIKQSKDVKLLPPPKKRN
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006308 | DNA catabolic process | biological_proccess | IDA |
GO:0006310 | DNA recombination | biological_proccess | IMP |
GO:0006401 | RNA catabolic process | biological_proccess | IDA |
GO:0006915 | apoptosis | biological_proccess | IMP |
GO:0042254 | ribosome biogenesis | biological_proccess | RCA |
GO:0000287 | magnesium ion binding | mollecular_function | IEA |
GO:0003676 | nucleic acid binding | mollecular_function | IEA |
GO:0004518 | nuclease activity | mollecular_function | IEA |
GO:0004519 | endonuclease activity | mollecular_function | IEA |
GO:0004520 | endodeoxyribonuclease activity | mollecular_function | IDA |
GO:0004529 | exodeoxyribonuclease activity | mollecular_function | IDA |
GO:0004540 | ribonuclease activity | mollecular_function | IDA |
GO:0016787 | hydrolase activity | mollecular_function | IEA |
GO:0030145 | manganese ion binding | mollecular_function | IEA |
GO:0046872 | metal ion binding | mollecular_function | IEA |
GO:0005634 | nucleus | cell_component | IDA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005743 | mitochondrial inner membrane | cell_component | IDA |
GO:0016020 | membrane | cell_component | IEA |
Check GO Evidence Codes here