ADK2 (Saccharomyces cerevisiae)
Description [+]
- Synonyms: ADK2
- Species: Saccharomyces cerevisiae
- Short gene description: Adenylate kinase 2 (EC 2.7.4.3) (ATP-AMP transphosphorylase). [Source:UniProtKB/Swiss-Prot;Acc:P26364]
- Family: Null
- Process:
- Pathways:
- Criteria: homology
- Curator comment: Null
- WIKI: ADK2-S_cerevisiae
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | ADK | 19 | 209 |
PFAM A | ADK_lid | 145 | 180 |
Protein sequence [+]
ADK2 | Saccharomyces cerevisiae | 4932 | length:225
MKADAKQITHLLKPLRLLLLGAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEIKSESTL
GREATTYIAQGKLLPDDLITRLITFRLSALGWLKPSAMWLLDGFPRTTAQASALDELLKQ
HDASLNLVVELDVPESTILERIENRYVHVPSGRVYNLQYNPPKVPGLDDITGEPLTKRLD
DTAEVFKKRLEEYKKTNEPLKDYYKKSGIFGTVSGETSDIIFRNY
GREATTYIAQGKLLPDDLITRLITFRLSALGWLKPSAMWLLDGFPRTTAQASALDELLKQ
HDASLNLVVELDVPESTILERIENRYVHVPSGRVYNLQYNPPKVPGLDDITGEPLTKRLD
DTAEVFKKRLEEYKKTNEPLKDYYKKSGIFGTVSGETSDIIFRNY
Structure links:
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0006139 | nucleobase, nucleoside, nucleotide and nucleic acid metabolic process | biological_proccess | IEA |
GO:0009117 | nucleotide metabolic process | biological_proccess | IDA |
GO:0004017 | adenylate kinase activity | mollecular_function | IEA |
GO:0005524 | ATP binding | mollecular_function | IEA |
GO:0016301 | kinase activity | mollecular_function | IEA |
GO:0016740 | transferase activity | mollecular_function | IEA |
GO:0016776 | phosphotransferase activity, phosphate group as acceptor | mollecular_function | IEA |
GO:0019201 | nucleotide kinase activity | mollecular_function | IEA |
GO:0019205 | nucleobase, nucleoside, nucleotide kinase activity | mollecular_function | IEA |
GO:0000166 | nucleotide binding | mollecular_function | IEA |
GO:0046899 | nucleoside triphosphate adenylate kinase activity | mollecular_function | IDA |
GO:0005739 | mitochondrion | cell_component | IEA |
GO:0005743 | mitochondrial inner membrane | cell_component | IDA |
Check GO Evidence Codes here