PRDX6 (Rattus norvegicus)
Description [+]
- Synonyms: PRDX6
- Species: Metazoa;Bilateria;Deuterostoma;Chordata;Vertebrata;Mammalia;Rodentia; Rattus norvegicus
- Short gene description: Peroxiredoxin-6 (EC 1.11.1.15) (Antioxidant protein 2) (1-Cys peroxiredoxin) (1-Cys PRX) (Acidic calcium-independent phospholipase A2) (EC 3.1.1.-) (aiPLA2) (Non-selenium glutathione peroxidase) (EC 1.11.1.7) (NSGPx) (Thiol-specific antioxidant protein). [Source:UniProtKB/Swiss-Prot;Acc:O35244]
- Family: Null
- Process:
- Pathways:
- Criteria: homology search
- Curator comment: Null
- WIKI: PRDX6-R_norvegicus
Structure & Sequence [+]
Pfam domains:
(Pfam is a large collection of protein families.)
Source | Domain Name | Start | End |
---|---|---|---|
PFAM A | AhpC-TSA | 7 | 146 |
PFAM A | 1-cysPrx_C | 156 | 218 |
Protein sequence [+]
Prdx6 | Rattus norvegicus | 10116 | length:224
MPGGLLLGDEAPNFEANTTIGHIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPE
FAKRNVKLIALSIDSVEDHFAWSKDINAYNGAAPTEKLPFPIIDDKDRDLAILLGMLDPA
EKDEKGMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTASNPVATPVD
WKKGESVMVLPTLPEEEAKQLFPKGVFTKELPSGKKYLRYTPQP
FAKRNVKLIALSIDSVEDHFAWSKDINAYNGAAPTEKLPFPIIDDKDRDLAILLGMLDPA
EKDEKGMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTASNPVATPVD
WKKGESVMVLPTLPEEEAKQLFPKGVFTKELPSGKKYLRYTPQP
Evolution [+]
Explore tree at phylomeDB:   Click here.
DeathBase uses Jalview, an external application that requires Java. Please, check that you have the latest version of Java
installed and that Java is enabled in your browser. When correctly installed your browser should display the following examples properly. You can download the latest version of Java at Java Download Site.
Gene Ontology [+]
GO id | Name | Ontology type | Evidence |
---|---|---|---|
GO:0016042 | lipid catabolic process | biological_proccess | IEA |
GO:0042744 | hydrogen peroxide catabolic process | biological_proccess | IDA |
GO:0045454 | cell redox homeostasis | biological_proccess | IEA |
GO:0055114 | oxidation reduction | biological_proccess | IEA |
GO:0006979 | response to oxidative stress | biological_proccess | IEA |
GO:0009395 | phospholipid catabolic process | biological_proccess | IEA |
GO:0004602 | glutathione peroxidase activity | mollecular_function | IDA |
GO:0016491 | oxidoreductase activity | mollecular_function | IEA |
GO:0016787 | hydrolase activity | mollecular_function | IEA |
GO:0051920 | peroxiredoxin activity | mollecular_function | IEA |
GO:0016209 | antioxidant activity | mollecular_function | IEA |
GO:0004623 | phospholipase A2 activity | mollecular_function | IEA |
GO:0005737 | cytoplasm | cell_component | IEA |
GO:0005764 | lysosome | cell_component | IEA |
GO:0005634 | nucleus | cell_component | IEA |
Check GO Evidence Codes here
KEGG Pathways [+]
Information from other databases [+]
- Ensembl genome browser [?] : ENSRNOG00000002896
- Expression info from Arrayexpress [?] : ENSRNOG00000002896
- Protein expression from Protein Atlas: [?] ENSRNOG00000002896
Click on [?] for more information.